From patchwork Mon Oct 24 19:21:00 2022 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: "Rafael J. Wysocki" X-Patchwork-Id: 10413 Return-Path: Delivered-To: ouuuleilei@gmail.com Received: by 2002:a5d:6687:0:0:0:0:0 with SMTP id l7csp716523wru; Mon, 24 Oct 2022 17:10:34 -0700 (PDT) X-Google-Smtp-Source: AMsMyM7oIVBC0YhESwzWi0OvyDxkavjiUR3FGmmn+ernZrPzcSjc/0W0vMVd8XtPAru2nSA1jE9D X-Received: by 2002:a17:90b:2241:b0:212:e24a:5e8d with SMTP id hk1-20020a17090b224100b00212e24a5e8dmr17128752pjb.229.1666656634058; Mon, 24 Oct 2022 17:10:34 -0700 (PDT) ARC-Seal: i=1; a=rsa-sha256; t=1666656634; cv=none; d=google.com; s=arc-20160816; b=zhyxgaONyxe6sJV5tbeTCbQy8kGRc/eU/txyrR807nhY1TGdVGx4LJojiI4q5vrc9c S/pCUZxoCE5FWrykfx8ltyZbzTlsRE+ur/RoHp/1WANySOPWTUmb6+dBUEaBD1jtdYaq rXPybhev3cYkPvXhcpEhOFKcOoRsT7Ld/lgmUL7qIfEtTEiugEoyIe/ss/NutahOksUj hrGjTiqUOMTxID9ldmmICnPotwXJVl6cbHgsO+24t6jg66qYEcOLERmQr12gy2Mj2vXN gAkH0paRE92VWunGfH9ixK3+0t/lec9kdY/s2BZyIJBmJfR/iyYswt6R89xo3Lq9qONf DboA== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816; h=list-id:precedence:content-transfer-encoding:mime-version :references:in-reply-to:message-id:date:subject:cc:to:from; bh=PtEw5+vs6X0FyIe/3zYCAVI1EuFLHMJdNotHQJyXq0w=; b=Z6Rrr5c1GTnx2630NoyzKMW9FqXtJp3FdZZHYUiQuIFDu0Er1Qrfh8ipf+b+gQsQ7X yk6Djg3plhOuQxezpaz9vTspVHVoFtIqW0YfGXtmmK7XYUJCq43z+j43WwzlV1HllThO RrOTlaj6VEXDOKP/4pqrBEmXtc6t9+xerjpvClY7EnBBqiOx5vS/sAPQUEaJUpug6WA8 7C0rAOyvfJXPWlk3Qzavy9wFmdO6IPL32FwcT4YIOBQjzMa2psE+XYcmI1cESVulU6/Y b8gNYJnayFUgZ/lrsn2qTqqpwvT4TrqB56p1rCf5uzHUN0pOgU4+x/LnC6m7+p9YlAYd mdiw== ARC-Authentication-Results: i=1; mx.google.com; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::1:20 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Received: from out1.vger.email (out1.vger.email. [2620:137:e000::1:20]) by mx.google.com with ESMTP id pq9-20020a17090b3d8900b0020d5dfb9d69si1353364pjb.187.2022.10.24.17.10.20; Mon, 24 Oct 2022 17:10:34 -0700 (PDT) Received-SPF: pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::1:20 as permitted sender) client-ip=2620:137:e000::1:20; Authentication-Results: mx.google.com; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::1:20 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S230144AbiJXXxW (ORCPT + 99 others); Mon, 24 Oct 2022 19:53:22 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:35264 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S230038AbiJXXxA (ORCPT ); Mon, 24 Oct 2022 19:53:00 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id 9127A3362FE; Mon, 24 Oct 2022 15:10:49 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.0.0) id 1e047c12660352c6; Mon, 24 Oct 2022 21:23:36 +0200 Received: from kreacher.localnet (unknown [213.134.163.181]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id 46B5F6692BC; Mon, 24 Oct 2022 21:23:35 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux PM Cc: LKML , Len Brown , Srinivas Pandruvada , Linux ACPI Subject: [PATCH v1 1/2] cpufreq: intel_pstate: Read all MSRs on the target CPU Date: Mon, 24 Oct 2022 21:21:00 +0200 Message-ID: <3195597.aeNJFYEL58@kreacher> In-Reply-To: <2258064.ElGaqSPkdT@kreacher> References: <2258064.ElGaqSPkdT@kreacher> MIME-Version: 1.0 X-CLIENT-IP: 213.134.163.181 X-CLIENT-HOSTNAME: 213.134.163.181 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedvfedrgedtgedgudefudcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffogffrnfdpggftiffpkfenuceurghilhhouhhtmecuudehtdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvvefufffkjghfggfgtgesthfuredttddtjeenucfhrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqeenucggtffrrghtthgvrhhnpedvffeuiedtgfdvtddugeeujedtffetteegfeekffdvfedttddtuefhgeefvdejhfenucfkphepvddufedrudefgedrudeifedrudekudenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpedvudefrddufeegrdduieefrddukedupdhhvghlohepkhhrvggrtghhvghrrdhlohgtrghlnhgvthdpmhgrihhlfhhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqpdhnsggprhgtphhtthhopeehpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhgvnhdrsghrohifnhesihhnthgvlhdrtghomhdprhgtphhtthhopehsrhhinhhivhgrshdrphgrnhgurhhuvhgruggrsehlihhnuhigrdhinhhtvghl rdgtohhmpdhrtghpthhtoheplhhinhhugidqrggtphhisehvghgvrhdrkhgvrhhnvghlrdhorhhg X-DCC--Metrics: v370.home.net.pl 1024; Body=5 Fuz1=5 Fuz2=5 X-Spam-Status: No, score=-1.9 required=5.0 tests=BAYES_00,SPF_HELO_NONE, SPF_PASS autolearn=ham autolearn_force=no version=3.4.6 X-Spam-Checker-Version: SpamAssassin 3.4.6 (2021-04-09) on lindbergh.monkeyblade.net Precedence: bulk List-ID: X-Mailing-List: linux-kernel@vger.kernel.org X-getmail-retrieved-from-mailbox: =?utf-8?q?INBOX?= X-GMAIL-THRID: =?utf-8?q?1747616146520982310?= X-GMAIL-MSGID: =?utf-8?q?1747616146520982310?= From: Rafael J. Wysocki Some of the MSR accesses in intel_pstate are carried out on the CPU that is running the code, but the values coming from them are used for the performance scaling of the other CPUs. This is problematic, for example, on hybrid platforms where MSR_TURBO_RATIO_LIMIT for P-cores and E-cores is different, so the values read from it on a P-core are generally not applicable to E-cores and the other way around. For this reason, make the driver access all MSRs on the target CPU on platforms using the "core" pstate_funcs callbacks which is the case for all of the hybrid platforms released to date. For this purpose, pass a CPU argument to the ->get_max(), ->get_max_physical(), ->get_min() and ->get_turbo() pstate_funcs callbacks and from there pass it to rdmsrl_on_cpu() or rdmsrl_safe_on_cpu() to access the MSR on the target CPU. Fixes: 46573fd6369f ("cpufreq: intel_pstate: hybrid: Rework HWP calibration") Signed-off-by: Rafael J. Wysocki --- drivers/cpufreq/intel_pstate.c | 66 ++++++++++++++++++++--------------------- 1 file changed, 33 insertions(+), 33 deletions(-) Index: linux-pm/drivers/cpufreq/intel_pstate.c =================================================================== --- linux-pm.orig/drivers/cpufreq/intel_pstate.c +++ linux-pm/drivers/cpufreq/intel_pstate.c @@ -280,10 +280,10 @@ static struct cpudata **all_cpu_data; * structure is used to store those callbacks. */ struct pstate_funcs { - int (*get_max)(void); - int (*get_max_physical)(void); - int (*get_min)(void); - int (*get_turbo)(void); + int (*get_max)(int cpu); + int (*get_max_physical)(int cpu); + int (*get_min)(int cpu); + int (*get_turbo)(int cpu); int (*get_scaling)(void); int (*get_cpu_scaling)(int cpu); int (*get_aperf_mperf_shift)(void); @@ -531,12 +531,12 @@ static void intel_pstate_hybrid_hwp_adju { int perf_ctl_max_phys = cpu->pstate.max_pstate_physical; int perf_ctl_scaling = cpu->pstate.perf_ctl_scaling; - int perf_ctl_turbo = pstate_funcs.get_turbo(); + int perf_ctl_turbo = pstate_funcs.get_turbo(cpu->cpu); int turbo_freq = perf_ctl_turbo * perf_ctl_scaling; int scaling = cpu->pstate.scaling; pr_debug("CPU%d: perf_ctl_max_phys = %d\n", cpu->cpu, perf_ctl_max_phys); - pr_debug("CPU%d: perf_ctl_max = %d\n", cpu->cpu, pstate_funcs.get_max()); + pr_debug("CPU%d: perf_ctl_max = %d\n", cpu->cpu, pstate_funcs.get_max(cpu->cpu)); pr_debug("CPU%d: perf_ctl_turbo = %d\n", cpu->cpu, perf_ctl_turbo); pr_debug("CPU%d: perf_ctl_scaling = %d\n", cpu->cpu, perf_ctl_scaling); pr_debug("CPU%d: HWP_CAP guaranteed = %d\n", cpu->cpu, cpu->pstate.max_pstate); @@ -1740,7 +1740,7 @@ static void intel_pstate_hwp_enable(stru intel_pstate_update_epp_defaults(cpudata); } -static int atom_get_min_pstate(void) +static int atom_get_min_pstate(int not_used) { u64 value; @@ -1748,7 +1748,7 @@ static int atom_get_min_pstate(void) return (value >> 8) & 0x7F; } -static int atom_get_max_pstate(void) +static int atom_get_max_pstate(int not_used) { u64 value; @@ -1756,7 +1756,7 @@ static int atom_get_max_pstate(void) return (value >> 16) & 0x7F; } -static int atom_get_turbo_pstate(void) +static int atom_get_turbo_pstate(int not_used) { u64 value; @@ -1834,23 +1834,23 @@ static void atom_get_vid(struct cpudata cpudata->vid.turbo = value & 0x7f; } -static int core_get_min_pstate(void) +static int core_get_min_pstate(int cpu) { u64 value; - rdmsrl(MSR_PLATFORM_INFO, value); + rdmsrl_on_cpu(cpu, MSR_PLATFORM_INFO, &value); return (value >> 40) & 0xFF; } -static int core_get_max_pstate_physical(void) +static int core_get_max_pstate_physical(int cpu) { u64 value; - rdmsrl(MSR_PLATFORM_INFO, value); + rdmsrl_on_cpu(cpu, MSR_PLATFORM_INFO, &value); return (value >> 8) & 0xFF; } -static int core_get_tdp_ratio(u64 plat_info) +static int core_get_tdp_ratio(int cpu, u64 plat_info) { /* Check how many TDP levels present */ if (plat_info & 0x600000000) { @@ -1860,13 +1860,13 @@ static int core_get_tdp_ratio(u64 plat_i int err; /* Get the TDP level (0, 1, 2) to get ratios */ - err = rdmsrl_safe(MSR_CONFIG_TDP_CONTROL, &tdp_ctrl); + err = rdmsrl_safe_on_cpu(cpu, MSR_CONFIG_TDP_CONTROL, &tdp_ctrl); if (err) return err; /* TDP MSR are continuous starting at 0x648 */ tdp_msr = MSR_CONFIG_TDP_NOMINAL + (tdp_ctrl & 0x03); - err = rdmsrl_safe(tdp_msr, &tdp_ratio); + err = rdmsrl_safe_on_cpu(cpu, tdp_msr, &tdp_ratio); if (err) return err; @@ -1883,7 +1883,7 @@ static int core_get_tdp_ratio(u64 plat_i return -ENXIO; } -static int core_get_max_pstate(void) +static int core_get_max_pstate(int cpu) { u64 tar; u64 plat_info; @@ -1891,10 +1891,10 @@ static int core_get_max_pstate(void) int tdp_ratio; int err; - rdmsrl(MSR_PLATFORM_INFO, plat_info); + rdmsrl_on_cpu(cpu, MSR_PLATFORM_INFO, &plat_info); max_pstate = (plat_info >> 8) & 0xFF; - tdp_ratio = core_get_tdp_ratio(plat_info); + tdp_ratio = core_get_tdp_ratio(cpu, plat_info); if (tdp_ratio <= 0) return max_pstate; @@ -1903,7 +1903,7 @@ static int core_get_max_pstate(void) return tdp_ratio; } - err = rdmsrl_safe(MSR_TURBO_ACTIVATION_RATIO, &tar); + err = rdmsrl_safe_on_cpu(cpu, MSR_TURBO_ACTIVATION_RATIO, &tar); if (!err) { int tar_levels; @@ -1918,13 +1918,13 @@ static int core_get_max_pstate(void) return max_pstate; } -static int core_get_turbo_pstate(void) +static int core_get_turbo_pstate(int cpu) { u64 value; int nont, ret; - rdmsrl(MSR_TURBO_RATIO_LIMIT, value); - nont = core_get_max_pstate(); + rdmsrl_on_cpu(cpu, MSR_TURBO_RATIO_LIMIT, &value); + nont = core_get_max_pstate(cpu); ret = (value) & 255; if (ret <= nont) ret = nont; @@ -1952,13 +1952,13 @@ static int knl_get_aperf_mperf_shift(voi return 10; } -static int knl_get_turbo_pstate(void) +static int knl_get_turbo_pstate(int cpu) { u64 value; int nont, ret; - rdmsrl(MSR_TURBO_RATIO_LIMIT, value); - nont = core_get_max_pstate(); + rdmsrl_on_cpu(cpu, MSR_TURBO_RATIO_LIMIT, &value); + nont = core_get_max_pstate(cpu); ret = (((value) >> 8) & 0xFF); if (ret <= nont) ret = nont; @@ -2025,10 +2025,10 @@ static void intel_pstate_max_within_limi static void intel_pstate_get_cpu_pstates(struct cpudata *cpu) { - int perf_ctl_max_phys = pstate_funcs.get_max_physical(); + int perf_ctl_max_phys = pstate_funcs.get_max_physical(cpu->cpu); int perf_ctl_scaling = pstate_funcs.get_scaling(); - cpu->pstate.min_pstate = pstate_funcs.get_min(); + cpu->pstate.min_pstate = pstate_funcs.get_min(cpu->cpu); cpu->pstate.max_pstate_physical = perf_ctl_max_phys; cpu->pstate.perf_ctl_scaling = perf_ctl_scaling; @@ -2044,8 +2044,8 @@ static void intel_pstate_get_cpu_pstates } } else { cpu->pstate.scaling = perf_ctl_scaling; - cpu->pstate.max_pstate = pstate_funcs.get_max(); - cpu->pstate.turbo_pstate = pstate_funcs.get_turbo(); + cpu->pstate.max_pstate = pstate_funcs.get_max(cpu->cpu); + cpu->pstate.turbo_pstate = pstate_funcs.get_turbo(cpu->cpu); } if (cpu->pstate.scaling == perf_ctl_scaling) { @@ -3221,9 +3221,9 @@ static unsigned int force_load __initdat static int __init intel_pstate_msrs_not_valid(void) { - if (!pstate_funcs.get_max() || - !pstate_funcs.get_min() || - !pstate_funcs.get_turbo()) + if (!pstate_funcs.get_max(0) || + !pstate_funcs.get_min(0) || + !pstate_funcs.get_turbo(0)) return -ENODEV; return 0; From patchwork Mon Oct 24 19:22:48 2022 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: "Rafael J. Wysocki" X-Patchwork-Id: 10414 Return-Path: Delivered-To: ouuuleilei@gmail.com Received: by 2002:a5d:6687:0:0:0:0:0 with SMTP id l7csp716673wru; Mon, 24 Oct 2022 17:11:02 -0700 (PDT) X-Google-Smtp-Source: AMsMyM5chywZnsI4Eo65vyCP56+VLC0eJzx4o34IvQtjXZqPVPSnKIKQ02MoCMCfHlE3YvpUACGN X-Received: by 2002:a05:6a00:cc6:b0:56c:84c:856d with SMTP id b6-20020a056a000cc600b0056c084c856dmr3236556pfv.56.1666656662269; Mon, 24 Oct 2022 17:11:02 -0700 (PDT) ARC-Seal: i=1; a=rsa-sha256; t=1666656662; cv=none; d=google.com; s=arc-20160816; b=CcmjxQu1L+r5RuGF/GP2u5eeBxyu8dCJj757lhgwcBQbFHWAvLeLXcGhrHPzhgYDFR hyT60xK4Hx+zUQK9/CDy0n3qGJZV2E8Thdduyb7VGwdC4/ZwEdU5zkZ1EvBqKkc0FZTs HWWK+aMQTa+OTwDe14hwYaSMFZ91icjdtPsGk36we/+ZwA4hhWSEe3vLxcXFLFtmzAE1 n+do9lztqGfrceBPTfEHIpfRMInPSWII4Zn2dHJEzn/wBLsRN+motCP4IaXsaDQNAJ5O B57rAq4E9KKNE5VdXmPKlpLVVqm5bhE7TnmB///nIDIfflQ/2lxe6qiyDUf61c+Y72a+ G6Mw== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816; h=list-id:precedence:content-transfer-encoding:mime-version :references:in-reply-to:message-id:date:subject:cc:to:from; bh=DxusnJQ01VARcSV1B+g+or2v5/5Ri6ODDvYfxzfy0Fs=; b=gCezLsl57RLiUpzTy4E+EfuZepXYWFNDQrlWMMEadWgpbq9P69Oh4/nTxJ29PuX8OT 3LQt7/cpqiN9kFo4tIrrCV+p40jHcQo+HSnJg9JKFHoh9OLLtq3g6/Qb3gqxR3ZqQ9SA ALqrKhLOwUDaA/TSHSlBx1R34fwnaeiKZHOLsDnEBANJKbK7baAaTQG8j83V1VWcsH4+ Maih/oIdf+i5EduJyaHMdDr+Pc/GOFf8fJewIGx9Ysk8ZrdC+qJyLwpmRVgSZbJHuOVg fn7WHJMMRWpxh2PDNOd5xlKGBAMcDJt/z2TnBjkP6o98opzCcxGivCodS4CXi4l0anyp REug== ARC-Authentication-Results: i=1; mx.google.com; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::1:20 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Received: from out1.vger.email (out1.vger.email. [2620:137:e000::1:20]) by mx.google.com with ESMTP id u24-20020a656718000000b0046ade103855si1002816pgf.312.2022.10.24.17.10.49; Mon, 24 Oct 2022 17:11:02 -0700 (PDT) Received-SPF: pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::1:20 as permitted sender) client-ip=2620:137:e000::1:20; Authentication-Results: mx.google.com; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::1:20 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S230056AbiJXXx4 (ORCPT + 99 others); Mon, 24 Oct 2022 19:53:56 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:39268 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S230363AbiJXXxT (ORCPT ); Mon, 24 Oct 2022 19:53:19 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id 94B8F1911C5; Mon, 24 Oct 2022 15:10:59 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.0.0) id 7f9f6f99fe18a591; Mon, 24 Oct 2022 21:23:34 +0200 Received: from kreacher.localnet (unknown [213.134.163.181]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id D31266692BC; Mon, 24 Oct 2022 21:23:33 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux PM Cc: LKML , Len Brown , Srinivas Pandruvada , Linux ACPI Subject: [PATCH v1 2/2] cpufreq: intel_pstate: hybrid: Use known scaling factor for P-cores Date: Mon, 24 Oct 2022 21:22:48 +0200 Message-ID: <8132750.T7Z3S40VBb@kreacher> In-Reply-To: <2258064.ElGaqSPkdT@kreacher> References: <2258064.ElGaqSPkdT@kreacher> MIME-Version: 1.0 X-CLIENT-IP: 213.134.163.181 X-CLIENT-HOSTNAME: 213.134.163.181 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedvfedrgedtgedgudefudcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffogffrnfdpggftiffpkfenuceurghilhhouhhtmecuudehtdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvvefufffkjghfggfgtgesthfuredttddtjeenucfhrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqeenucggtffrrghtthgvrhhnpedvffeuiedtgfdvtddugeeujedtffetteegfeekffdvfedttddtuefhgeefvdejhfenucfkphepvddufedrudefgedrudeifedrudekudenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpedvudefrddufeegrdduieefrddukedupdhhvghlohepkhhrvggrtghhvghrrdhlohgtrghlnhgvthdpmhgrihhlfhhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqpdhnsggprhgtphhtthhopeehpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhgvnhdrsghrohifnhesihhnthgvlhdrtghomhdprhgtphhtthhopehsrhhinhhivhgrshdrphgrnhgurhhuvhgruggrsehlihhnuhigrdhinhhtvghl rdgtohhmpdhrtghpthhtoheplhhinhhugidqrggtphhisehvghgvrhdrkhgvrhhnvghlrdhorhhg X-DCC--Metrics: v370.home.net.pl 1024; Body=5 Fuz1=5 Fuz2=5 X-Spam-Status: No, score=-1.9 required=5.0 tests=BAYES_00,SPF_HELO_NONE, SPF_PASS autolearn=ham autolearn_force=no version=3.4.6 X-Spam-Checker-Version: SpamAssassin 3.4.6 (2021-04-09) on lindbergh.monkeyblade.net Precedence: bulk List-ID: X-Mailing-List: linux-kernel@vger.kernel.org X-getmail-retrieved-from-mailbox: =?utf-8?q?INBOX?= X-GMAIL-THRID: =?utf-8?q?1747616176536826489?= X-GMAIL-MSGID: =?utf-8?q?1747616176536826489?= From: Rafael J. Wysocki Commit 46573fd6369f ("cpufreq: intel_pstate: hybrid: Rework HWP calibration") attempted to use the information from CPPC (the nominal performance in particular) to obtain the scaling factor allowing the frequency to be computed if the HWP performance level of the given CPU is known or vice versa. However, it turns out that on some platforms this doesn't work, because the CPPC information on them does not align with the contents of the MSR_HWP_CAPABILITIES registers. This basically means that the only way to make intel_pstate work on all of the hybrid platforms to date is to use the observation that on all of them the scaling factor between the HWP performance levels and frequency for P-cores is 78741 (approximately 100000/1.27). For E-cores it is 100000, which is the same as for all of the non-hybrid "core" platforms and does not require any changes. Accordingly, make intel_pstate use 78741 as the scaling factor between HWP performance levels and frequency for P-cores on all hybrid platforms and drop the dependency of the HWP calibration code on CPPC. Fixes: 46573fd6369f ("cpufreq: intel_pstate: hybrid: Rework HWP calibration") Reported-by: Srinivas Pandruvada Signed-off-by: Rafael J. Wysocki --- drivers/cpufreq/intel_pstate.c | 69 ++++++++--------------------------------- 1 file changed, 15 insertions(+), 54 deletions(-) Index: linux-pm/drivers/cpufreq/intel_pstate.c =================================================================== --- linux-pm.orig/drivers/cpufreq/intel_pstate.c +++ linux-pm/drivers/cpufreq/intel_pstate.c @@ -27,6 +27,7 @@ #include #include +#include #include #include #include @@ -398,16 +399,6 @@ static int intel_pstate_get_cppc_guarant return cppc_perf.nominal_perf; } - -static u32 intel_pstate_cppc_nominal(int cpu) -{ - u64 nominal_perf; - - if (cppc_get_nominal_perf(cpu, &nominal_perf)) - return 0; - - return nominal_perf; -} #else /* CONFIG_ACPI_CPPC_LIB */ static inline void intel_pstate_set_itmt_prio(int cpu) { @@ -532,34 +523,17 @@ static void intel_pstate_hybrid_hwp_adju int perf_ctl_max_phys = cpu->pstate.max_pstate_physical; int perf_ctl_scaling = cpu->pstate.perf_ctl_scaling; int perf_ctl_turbo = pstate_funcs.get_turbo(cpu->cpu); - int turbo_freq = perf_ctl_turbo * perf_ctl_scaling; int scaling = cpu->pstate.scaling; pr_debug("CPU%d: perf_ctl_max_phys = %d\n", cpu->cpu, perf_ctl_max_phys); - pr_debug("CPU%d: perf_ctl_max = %d\n", cpu->cpu, pstate_funcs.get_max(cpu->cpu)); pr_debug("CPU%d: perf_ctl_turbo = %d\n", cpu->cpu, perf_ctl_turbo); pr_debug("CPU%d: perf_ctl_scaling = %d\n", cpu->cpu, perf_ctl_scaling); pr_debug("CPU%d: HWP_CAP guaranteed = %d\n", cpu->cpu, cpu->pstate.max_pstate); pr_debug("CPU%d: HWP_CAP highest = %d\n", cpu->cpu, cpu->pstate.turbo_pstate); pr_debug("CPU%d: HWP-to-frequency scaling factor: %d\n", cpu->cpu, scaling); - /* - * If the product of the HWP performance scaling factor and the HWP_CAP - * highest performance is greater than the maximum turbo frequency - * corresponding to the pstate_funcs.get_turbo() return value, the - * scaling factor is too high, so recompute it to make the HWP_CAP - * highest performance correspond to the maximum turbo frequency. - */ - cpu->pstate.turbo_freq = cpu->pstate.turbo_pstate * scaling; - if (turbo_freq < cpu->pstate.turbo_freq) { - cpu->pstate.turbo_freq = turbo_freq; - scaling = DIV_ROUND_UP(turbo_freq, cpu->pstate.turbo_pstate); - cpu->pstate.scaling = scaling; - - pr_debug("CPU%d: refined HWP-to-frequency scaling factor: %d\n", - cpu->cpu, scaling); - } - + cpu->pstate.turbo_freq = rounddown(cpu->pstate.turbo_pstate * scaling, + perf_ctl_scaling); cpu->pstate.max_freq = rounddown(cpu->pstate.max_pstate * scaling, perf_ctl_scaling); @@ -1965,37 +1939,24 @@ static int knl_get_turbo_pstate(int cpu) return ret; } -#ifdef CONFIG_ACPI_CPPC_LIB -static u32 hybrid_ref_perf; - -static int hybrid_get_cpu_scaling(int cpu) +static void hybrid_get_type(void *data) { - return DIV_ROUND_UP(core_get_scaling() * hybrid_ref_perf, - intel_pstate_cppc_nominal(cpu)); + u8 *cpu_type = data; + + *cpu_type = get_this_hybrid_cpu_type(); } -static void intel_pstate_cppc_set_cpu_scaling(void) +static int hybrid_get_cpu_scaling(int cpu) { - u32 min_nominal_perf = U32_MAX; - int cpu; + u8 cpu_type = 0; - for_each_present_cpu(cpu) { - u32 nominal_perf = intel_pstate_cppc_nominal(cpu); + smp_call_function_single(cpu, hybrid_get_type, &cpu_type, 1); + /* P-cores have a smaller perf level-to-freqency scaling factor. */ + if (cpu_type == 0x40) + return 78741; - if (nominal_perf && nominal_perf < min_nominal_perf) - min_nominal_perf = nominal_perf; - } - - if (min_nominal_perf < U32_MAX) { - hybrid_ref_perf = min_nominal_perf; - pstate_funcs.get_cpu_scaling = hybrid_get_cpu_scaling; - } + return core_get_scaling(); } -#else -static inline void intel_pstate_cppc_set_cpu_scaling(void) -{ -} -#endif /* CONFIG_ACPI_CPPC_LIB */ static void intel_pstate_set_pstate(struct cpudata *cpu, int pstate) { @@ -3450,7 +3411,7 @@ static int __init intel_pstate_init(void default_driver = &intel_pstate; if (boot_cpu_has(X86_FEATURE_HYBRID_CPU)) - intel_pstate_cppc_set_cpu_scaling(); + pstate_funcs.get_cpu_scaling = hybrid_get_cpu_scaling; goto hwp_cpu_matched; }