From patchwork Mon Aug 7 18:17:07 2023 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: "Rafael J. Wysocki" X-Patchwork-Id: 132320 Return-Path: Delivered-To: ouuuleilei@gmail.com Received: by 2002:a59:c44e:0:b0:3f2:4152:657d with SMTP id w14csp1643528vqr; Mon, 7 Aug 2023 11:51:52 -0700 (PDT) X-Google-Smtp-Source: AGHT+IGQgelb7TptwYZq2XNhStgur7/cFqdvknHNMl8/HxqEi7dj/FIK7vaI73rA9B5JftB7lNyd X-Received: by 2002:a17:906:3086:b0:99b:d2a9:9a01 with SMTP id 6-20020a170906308600b0099bd2a99a01mr9478768ejv.0.1691434312159; Mon, 07 Aug 2023 11:51:52 -0700 (PDT) ARC-Seal: i=1; a=rsa-sha256; t=1691434312; cv=none; d=google.com; s=arc-20160816; b=ASR1DxiGqV4NtYgoBAiabbMxLFSOyDPfu7rgM27bEhfF9yJxBjY3sLWujkJ0Swsezm HB7aymb8P5tqlVWHmM1+lDstn47i4OBKOHSRP5eyNgzv6604DsZ8ukIhVxSkeYzCC9GY nsc8mjZ4wRAnUVN6OBvIT4bfKqYU0XCUPADxReqQ6GMtjqcCHdr+rqBv+tV6nNc3Bp0b +EPZpZQCUxb2EWsKWnxn42lPmxCPf2UfvUKk8WwvH8fab+9ZIGUWRTK60V65lPe6S/rL rU4WfaFkhWfcja5KjwX1QEXKZA4+NLtJ2yatMvbdzq3TyKUhxGrwNr3iNPCDlsgbxL8t +YKA== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816; h=list-id:precedence:content-transfer-encoding:mime-version :references:in-reply-to:message-id:date:subject:cc:to:from; bh=FrVynI6GCLRmihmIwQKaIaxdukkwHSkNH0ovcMme+eQ=; fh=jABj5v2rHKw019HO9Ag6891M+lPZ6d+O4eAkd8el8mQ=; b=Jb4XA/1ExPIe5eODtxwYrguTW46kvse7NumPqG/XRxDE1G28fWQwJs8PxAz7ZABeAO KG5f4QKxBhmlYbm+F7DDoNA53utWRcxlA7dAptz6aW37IW0OpOK1br/mPZLJzMbzHVzl a4JPKh12WI85AXc8qaxtAqSH2BFoqGmYcP9RrhF6/ave809YhWp6GY6UIEkE7j3fQcm3 1/TPBc0GJnclFYU9KwkWNkUeHEavZYpWeqsuQqOkufBQ/dQ9udFB+MwSNnz2s8b6VWbJ aUKjpEBycA3F3pV/WbucHXegva/quTnW98uULg5lN43/u7OCeq6jJI+ARPhOcOEHF2yC D76w== ARC-Authentication-Results: i=1; mx.google.com; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::1:20 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Received: from out1.vger.email (out1.vger.email. [2620:137:e000::1:20]) by mx.google.com with ESMTP id p21-20020a170906229500b0099bd5561245si6367380eja.54.2023.08.07.11.51.28; Mon, 07 Aug 2023 11:51:52 -0700 (PDT) Received-SPF: pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::1:20 as permitted sender) client-ip=2620:137:e000::1:20; Authentication-Results: mx.google.com; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::1:20 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S231221AbjHGSVG (ORCPT + 99 others); Mon, 7 Aug 2023 14:21:06 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:53320 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S229880AbjHGSU6 (ORCPT ); Mon, 7 Aug 2023 14:20:58 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id 194A3194; Mon, 7 Aug 2023 11:20:56 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id e153a7dfbe3fa879; Mon, 7 Aug 2023 20:20:55 +0200 Authentication-Results: v370.home.net.pl; spf=softfail (domain owner discourages use of this host) smtp.mailfrom=rjwysocki.net (client-ip=195.136.19.94; helo=[195.136.19.94]; envelope-from=rjw@rjwysocki.net; receiver=) Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id B19566625B2; Mon, 7 Aug 2023 20:20:54 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux ACPI , Daniel Lezcano Cc: LKML , Linux PM , Michal Wilczynski , Zhang Rui , Srinivas Pandruvada Subject: [PATCH v5 09/11] ACPI: thermal: Rework thermal_get_trend() Date: Mon, 07 Aug 2023 20:17:07 +0200 Message-ID: <8296661.NyiUUSuA9g@kreacher> In-Reply-To: <4503814.LvFx2qVVIh@kreacher> References: <13318886.uLZWGnKmhe@kreacher> <4503814.LvFx2qVVIh@kreacher> MIME-Version: 1.0 X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrledtgdduudejucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffqoffgrffnpdggtffipffknecuuegrihhlohhuthemucduhedtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvfevufffkfgjfhgggfgtsehtufertddttdejnecuhfhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqnecuggftrfgrthhtvghrnhepvdffueeitdfgvddtudegueejtdffteetgeefkeffvdeftddttdeuhfegfedvjefhnecukfhppeduleehrddufeeirdduledrleegnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepudelhedrudefiedrudelrdelgedphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqedpnhgspghrtghpthhtohepjedprhgtphhtthhopehlihhnuhigqdgrtghpihesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopegurghnihgvlhdrlhgviigtrghnoheslhhinhgrrhhordhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghp thhtohepmhhitghhrghlrdifihhltgiihihnshhkihesihhnthgvlhdrtghomhdprhgtphhtthhopehruhhirdiihhgrnhhgsehinhhtvghlrdgtohhm X-DCC--Metrics: v370.home.net.pl 1024; Body=7 Fuz1=7 Fuz2=7 X-Spam-Status: No, score=-1.9 required=5.0 tests=BAYES_00, RCVD_IN_DNSWL_BLOCKED,SPF_HELO_NONE,SPF_PASS autolearn=ham autolearn_force=no version=3.4.6 X-Spam-Checker-Version: SpamAssassin 3.4.6 (2021-04-09) on lindbergh.monkeyblade.net Precedence: bulk List-ID: X-Mailing-List: linux-kernel@vger.kernel.org X-getmail-retrieved-from-mailbox: INBOX X-GMAIL-THRID: 1771784820687096789 X-GMAIL-MSGID: 1773597425091781478 From: Rafael J. Wysocki Rework the ACPI thermal driver's .get_trend() callback function, thermal_get_trend(), so that it does not call thermal_get_trip_type() and thermal_get_trip_temp() which are going to be dropped. This reduces the overhead of the function too, because it will always carry out a trip point lookup once after the change. Signed-off-by: Rafael J. Wysocki --- v4 -> v5: * Rebase on top of patches [07-08/11]. v3 -> v4: * Adjust for the lack of a direct way to get from the local trip point representations to trips[i]. v2 -> v3: Rebase on top of the v2 of the previous patch. v1 -> v2: * Do not acquire thermal_check_lock in thermal_get_trend() (lockdep would complain about this, because it is hold around thermal zone locking and .get_trend() runs under the thermal zone lock). The thermal zone locking added in the previous patches is sufficient to protect this code. * Check trips against invalid temperature values. * Return an error for trips other than passive and active. --- drivers/acpi/thermal.c | 68 +++++++++++++++++++++++++++---------------------- 1 file changed, 38 insertions(+), 30 deletions(-) Index: linux-pm/drivers/acpi/thermal.c =================================================================== --- linux-pm.orig/drivers/acpi/thermal.c +++ linux-pm/drivers/acpi/thermal.c @@ -597,46 +597,54 @@ static int thermal_get_crit_temp(struct } static int thermal_get_trend(struct thermal_zone_device *thermal, - int trip, enum thermal_trend *trend) + int trip_index, enum thermal_trend *trend) { struct acpi_thermal *tz = thermal_zone_device_priv(thermal); - enum thermal_trip_type type; - int i; + struct acpi_thermal_trip *acpi_trip; + int t, i; - if (thermal_get_trip_type(thermal, trip, &type)) + if (!tz || trip_index < 0) return -EINVAL; - if (type == THERMAL_TRIP_ACTIVE) { - int trip_temp; - int temp = deci_kelvin_to_millicelsius_with_offset( - tz->temperature, tz->kelvin_offset); - if (thermal_get_trip_temp(thermal, trip, &trip_temp)) - return -EINVAL; + if (tz->trips.critical.valid) + trip_index--; - if (temp > trip_temp) { + if (tz->trips.hot.valid) + trip_index--; + + if (trip_index < 0) + return -EINVAL; + + acpi_trip = &tz->trips.passive.trip; + if (acpi_trip->valid && !trip_index--) { + t = tz->trips.passive.tc1 * (tz->temperature - + tz->last_temperature) + + tz->trips.passive.tc2 * (tz->temperature - + acpi_trip->temperature); + if (t > 0) *trend = THERMAL_TREND_RAISING; - return 0; - } else { - /* Fall back on default trend */ - return -EINVAL; - } + else if (t < 0) + *trend = THERMAL_TREND_DROPPING; + else + *trend = THERMAL_TREND_STABLE; + + return 0; } - /* - * tz->temperature has already been updated by generic thermal layer, - * before this callback being invoked - */ - i = tz->trips.passive.tc1 * (tz->temperature - tz->last_temperature) + - tz->trips.passive.tc2 * (tz->temperature - tz->trips.passive.trip.temperature); - - if (i > 0) - *trend = THERMAL_TREND_RAISING; - else if (i < 0) - *trend = THERMAL_TREND_DROPPING; - else - *trend = THERMAL_TREND_STABLE; + t = acpi_thermal_temp(tz, tz->temperature); + + for (i = 0; i < ACPI_THERMAL_MAX_ACTIVE; i++) { + acpi_trip = &tz->trips.active[i].trip; + if (acpi_trip->valid && !trip_index--) { + if (t > acpi_thermal_temp(tz, acpi_trip->temperature)) { + *trend = THERMAL_TREND_RAISING; + return 0; + } + break; + } + } - return 0; + return -EINVAL; } static void acpi_thermal_zone_device_hot(struct thermal_zone_device *thermal)