From patchwork Thu Aug 10 19:16:14 2023 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: "Rafael J. Wysocki" X-Patchwork-Id: 134203 Return-Path: Delivered-To: ouuuleilei@gmail.com Received: by 2002:a59:b824:0:b0:3f2:4152:657d with SMTP id z4csp649077vqi; Thu, 10 Aug 2023 12:53:38 -0700 (PDT) X-Google-Smtp-Source: AGHT+IEtKp2n3ylARnlC2bV09Spi08Q/ZgTsivv6J09hvn7V1jCNm5vPQh2CA57gzHyr8EwJpb7l X-Received: by 2002:aa7:ccce:0:b0:523:1f33:cf9 with SMTP id y14-20020aa7ccce000000b005231f330cf9mr2890648edt.25.1691697217956; Thu, 10 Aug 2023 12:53:37 -0700 (PDT) ARC-Seal: i=1; a=rsa-sha256; t=1691697217; cv=none; d=google.com; s=arc-20160816; b=U7vhV+rG3Z+vch2+iN5wknTkWTZOItdS4AO51gwcKZuWZCDZs1hdbjYEuEyXTEUyzc 6Mnh+I0oWBF/aRqgx73SOrkSWBQrxT9uXs+k47YWG4w/OgnwbaAdRlE/gOZ1flBoy5OW Izdppa1oCNucAJ8MTeRWPivU3N818Mc5uMzriasU9DpgxkrBrJ7J6JxjOgbzPjr1nQZD 2NXYY3MOXylIDr967sHpW7U9+RlS+4sg8eue1ToTMQGY4VPRJSJmycLgaUqry9boGsAm mhdj/p5dGnLtjKvZZywat32b6+Og2RZQbVaQ3JQzVtI6r8ds2YTORn3naUPeVid5t/FQ LLHA== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816; h=list-id:precedence:content-transfer-encoding:mime-version :references:in-reply-to:message-id:date:subject:cc:to:from; bh=M/vlBif9aMiQm2hwge9WX3Mk5Qnv2rqdbkJQvgGenB8=; fh=aK1D4KsZYozI75a+KCLuU03FxwQ8tTCKnM2T8GQ5ByU=; b=LMS1sB8FkneA401QlIHw3x42jqYxakrdmXONA7gJwgHzSIYBmHJWJsu5XJqeyaOjPn adkvtixIOJj58G7KsA5tMYj6omIqCm9EYj/zj9fW71tHG1NUarpS+tRSODFaldXiYx4t j5oGBdWGPvSLx8nOjtCrODbOTSqNOUz9zQ13F6ZdYdOA8XBzREyNaefWFj3GNrX9IJV+ QG4Zxmn3KMtolIpDzD4GGcZewFBWcpVb7MsahVOPS7bUoPjsWoXcOtLZYH6LaYj5QbJq Rc8JbUjzsV/4hwBNC2G6lT3bjAmRJx6vzIhMdwaW82e5wfY+dwunSktCRLF3vMBJfw6U 7g7w== ARC-Authentication-Results: i=1; mx.google.com; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::1:20 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Received: from out1.vger.email (out1.vger.email. [2620:137:e000::1:20]) by mx.google.com with ESMTP id a23-20020aa7cf17000000b005231425d183si2140187edy.216.2023.08.10.12.53.14; Thu, 10 Aug 2023 12:53:37 -0700 (PDT) Received-SPF: pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::1:20 as permitted sender) client-ip=2620:137:e000::1:20; Authentication-Results: mx.google.com; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::1:20 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S231643AbjHJTRt (ORCPT + 99 others); Thu, 10 Aug 2023 15:17:49 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:53822 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S236300AbjHJTRr (ORCPT ); Thu, 10 Aug 2023 15:17:47 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id BE8842717; Thu, 10 Aug 2023 12:17:46 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id 1a9d5b36f8f22aa9; Thu, 10 Aug 2023 21:17:45 +0200 Authentication-Results: v370.home.net.pl; spf=softfail (domain owner discourages use of this host) smtp.mailfrom=rjwysocki.net (client-ip=195.136.19.94; helo=[195.136.19.94]; envelope-from=rjw@rjwysocki.net; receiver=) Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id C4FAB662742; Thu, 10 Aug 2023 21:17:44 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux PM Cc: LKML , Srinivas Pandruvada , Zhang Rui , Daniel Lezcano Subject: [PATCH v1 6/7] thermal: intel: intel_soc_dts_iosf: Rework critical trip setup Date: Thu, 10 Aug 2023 21:16:14 +0200 Message-ID: <8269586.T7Z3S40VBb@kreacher> In-Reply-To: <5713357.DvuYhMxLoT@kreacher> References: <5713357.DvuYhMxLoT@kreacher> MIME-Version: 1.0 X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrleeigddufeegucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffqoffgrffnpdggtffipffknecuuegrihhlohhuthemucduhedtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvfevufffkfgjfhgggfgtsehtufertddttdejnecuhfhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqnecuggftrfgrthhtvghrnhepvdffueeitdfgvddtudegueejtdffteetgeefkeffvdeftddttdeuhfegfedvjefhnecukfhppeduleehrddufeeirdduledrleegnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepudelhedrudefiedrudelrdelgedphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqedpnhgspghrtghpthhtohephedprhgtphhtthhopehlihhnuhigqdhpmhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdhkvghrnhgvlhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehsrhhinhhivhgrshdrphgrnhgurhhuvhgruggrsehlihhnuhigrdhinhhtvghlrdgtohhmpdhrtghpthhtoheprhhuihdriihhrghnghesihhnthgvlhdrtghomhdp rhgtphhtthhopegurghnihgvlhdrlhgviigtrghnoheslhhinhgrrhhordhorhhg X-DCC--Metrics: v370.home.net.pl 1024; Body=5 Fuz1=5 Fuz2=5 X-Spam-Status: No, score=-1.9 required=5.0 tests=BAYES_00, RCVD_IN_DNSWL_BLOCKED,SPF_HELO_NONE,SPF_PASS autolearn=ham autolearn_force=no version=3.4.6 X-Spam-Checker-Version: SpamAssassin 3.4.6 (2021-04-09) on lindbergh.monkeyblade.net Precedence: bulk List-ID: X-Mailing-List: linux-kernel@vger.kernel.org X-getmail-retrieved-from-mailbox: INBOX X-GMAIL-THRID: 1773873101731413709 X-GMAIL-MSGID: 1773873101731413709 From: Rafael J. Wysocki Critical trip points appear in the DTS thermal zones only after those thermal zones have been registered via intel_soc_dts_iosf_init(). Moreover, they are "created" by changing the type of an existing trip point from THERMAL_TRIP_PASSIVE to THERMAL_TRIP_CRITICAL via intel_soc_dts_iosf_add_read_only_critical_trip(), the caller of which has to be careful enough to pass at least 1 as the number of read-only trip points to intel_soc_dts_iosf_init() beforehand. This is questionable, because user space may have started to use the trips at the time when intel_soc_dts_iosf_add_read_only_critical_trip() runs and there is no synchronization between it and sys_set_trip_temp(). To address it, use the observation that nonzero number of read-only trip points is only passed to intel_soc_dts_iosf_init() when critical trip points are going to be used, so in fact that function may get all of the information regarding the critical trip points upfront and it can configure them before registering the corresponding thermal zones. Accordingly, replace the read_only_trip_count argument of intel_soc_dts_iosf_init() with a pair of new arguments related to critical trip points: a bool one indicating whether or not critical trip points are to be used at all and an int one representing the critical trip point temperature offset relative to Tj_max. Use these arguments to configure the critical trip points before the registration of the thermal zones and to compute the number of writeable trip points in add_dts_thermal_zone(). Modify both callers of intel_soc_dts_iosf_init() to take these changes into account and drop the intel_soc_dts_iosf_add_read_only_critical_trip() call, that is not necessary any more, from intel_soc_thermal_init(), which also allows it to return success right after requesting the IRQ. Finally, drop intel_soc_dts_iosf_add_read_only_critical_trip() altogether, because it does not have any more users. Signed-off-by: Rafael J. Wysocki --- drivers/thermal/intel/int340x_thermal/processor_thermal_device_pci_legacy.c | 2 drivers/thermal/intel/intel_soc_dts_iosf.c | 51 +++------- drivers/thermal/intel/intel_soc_dts_iosf.h | 8 - drivers/thermal/intel/intel_soc_dts_thermal.c | 17 --- 4 files changed, 27 insertions(+), 51 deletions(-) Index: linux-pm/drivers/thermal/intel/intel_soc_dts_iosf.c =================================================================== --- linux-pm.orig/drivers/thermal/intel/intel_soc_dts_iosf.c +++ linux-pm/drivers/thermal/intel/intel_soc_dts_iosf.c @@ -257,11 +257,11 @@ static void remove_dts_thermal_zone(stru } static int add_dts_thermal_zone(int id, struct intel_soc_dts_sensor_entry *dts, - int read_only_trip_cnt) + bool critical_trip) { + int writable_trip_cnt = SOC_MAX_DTS_TRIPS; char name[10]; unsigned long trip; - int writable_trip_cnt; int trip_mask; unsigned long ptps; u32 store_ptps; @@ -276,7 +276,9 @@ static int add_dts_thermal_zone(int id, dts->id = id; - writable_trip_cnt = SOC_MAX_DTS_TRIPS - read_only_trip_cnt; + if (critical_trip) + writable_trip_cnt--; + trip_mask = GENMASK(writable_trip_cnt - 1, 0); /* Check if the writable trip we provide is not used by BIOS */ @@ -315,25 +317,6 @@ err_ret: return ret; } -int intel_soc_dts_iosf_add_read_only_critical_trip( - struct intel_soc_dts_sensors *sensors, int critical_offset) -{ - int i, j; - - for (i = 0; i < SOC_MAX_DTS_SENSORS; ++i) { - struct intel_soc_dts_sensor_entry *entry = &sensors->soc_dts[i]; - int temp = sensors->tj_max - critical_offset; - unsigned long mask = entry->trip_mask; - - j = find_first_zero_bit(&mask, SOC_MAX_DTS_TRIPS); - if (j < SOC_MAX_DTS_TRIPS) - return configure_trip(entry, j, THERMAL_TRIP_CRITICAL, temp); - } - - return -EINVAL; -} -EXPORT_SYMBOL_GPL(intel_soc_dts_iosf_add_read_only_critical_trip); - void intel_soc_dts_iosf_interrupt_handler(struct intel_soc_dts_sensors *sensors) { u32 sticky_out; @@ -375,8 +358,9 @@ static void dts_trips_reset(struct intel configure_trip(&sensors->soc_dts[dts_index], 1, 0, 0); } -struct intel_soc_dts_sensors *intel_soc_dts_iosf_init( - enum intel_soc_dts_interrupt_type intr_type, int read_only_trip_count) +struct intel_soc_dts_sensors * +intel_soc_dts_iosf_init(enum intel_soc_dts_interrupt_type intr_type, + bool critical_trip, int crit_offset) { struct intel_soc_dts_sensors *sensors; int tj_max; @@ -386,9 +370,6 @@ struct intel_soc_dts_sensors *intel_soc_ if (!iosf_mbi_available()) return ERR_PTR(-ENODEV); - if (read_only_trip_count > SOC_MAX_DTS_TRIPS) - return ERR_PTR(-EINVAL); - tj_max = intel_tcc_get_tjmax(-1); if (tj_max < 0) return ERR_PTR(tj_max); @@ -403,6 +384,9 @@ struct intel_soc_dts_sensors *intel_soc_ sensors->tj_max = tj_max * 1000; for (i = 0; i < SOC_MAX_DTS_SENSORS; ++i) { + enum thermal_trip_type trip_type; + int temp; + sensors->soc_dts[i].sensors = sensors; ret = configure_trip(&sensors->soc_dts[i], 0, @@ -410,15 +394,20 @@ struct intel_soc_dts_sensors *intel_soc_ if (ret) goto err_reset_trips; - ret = configure_trip(&sensors->soc_dts[i], 1, - THERMAL_TRIP_PASSIVE, 0); + if (critical_trip) { + trip_type = THERMAL_TRIP_CRITICAL; + temp = sensors->tj_max - crit_offset; + } else { + trip_type = THERMAL_TRIP_PASSIVE; + temp = 0; + } + ret = configure_trip(&sensors->soc_dts[i], 1, trip_type, temp); if (ret) goto err_reset_trips; } for (i = 0; i < SOC_MAX_DTS_SENSORS; ++i) { - ret = add_dts_thermal_zone(i, &sensors->soc_dts[i], - read_only_trip_count); + ret = add_dts_thermal_zone(i, &sensors->soc_dts[i], critical_trip); if (ret) goto err_remove_zone; } Index: linux-pm/drivers/thermal/intel/intel_soc_dts_iosf.h =================================================================== --- linux-pm.orig/drivers/thermal/intel/intel_soc_dts_iosf.h +++ linux-pm/drivers/thermal/intel/intel_soc_dts_iosf.h @@ -42,11 +42,11 @@ struct intel_soc_dts_sensors { struct intel_soc_dts_sensor_entry soc_dts[SOC_MAX_DTS_SENSORS]; }; -struct intel_soc_dts_sensors *intel_soc_dts_iosf_init( - enum intel_soc_dts_interrupt_type intr_type, int read_only_trip_count); + +struct intel_soc_dts_sensors * +intel_soc_dts_iosf_init(enum intel_soc_dts_interrupt_type intr_type, + bool critical_trip, int crit_offset); void intel_soc_dts_iosf_exit(struct intel_soc_dts_sensors *sensors); void intel_soc_dts_iosf_interrupt_handler( struct intel_soc_dts_sensors *sensors); -int intel_soc_dts_iosf_add_read_only_critical_trip( - struct intel_soc_dts_sensors *sensors, int critical_offset); #endif Index: linux-pm/drivers/thermal/intel/int340x_thermal/processor_thermal_device_pci_legacy.c =================================================================== --- linux-pm.orig/drivers/thermal/intel/int340x_thermal/processor_thermal_device_pci_legacy.c +++ linux-pm/drivers/thermal/intel/int340x_thermal/processor_thermal_device_pci_legacy.c @@ -59,7 +59,7 @@ static int proc_thermal_pci_probe(struct * ACPI/MSR. So we don't want to fail for auxiliary DTSs. */ proc_priv->soc_dts = intel_soc_dts_iosf_init( - INTEL_SOC_DTS_INTERRUPT_MSI, 0); + INTEL_SOC_DTS_INTERRUPT_MSI, false, 0); if (!IS_ERR(proc_priv->soc_dts) && pdev->irq) { ret = pci_enable_msi(pdev); Index: linux-pm/drivers/thermal/intel/intel_soc_dts_thermal.c =================================================================== --- linux-pm.orig/drivers/thermal/intel/intel_soc_dts_thermal.c +++ linux-pm/drivers/thermal/intel/intel_soc_dts_thermal.c @@ -51,7 +51,8 @@ static int __init intel_soc_thermal_init return -ENODEV; /* Create a zone with 2 trips with marked as read only */ - soc_dts = intel_soc_dts_iosf_init(INTEL_SOC_DTS_INTERRUPT_APIC, 1); + soc_dts = intel_soc_dts_iosf_init(INTEL_SOC_DTS_INTERRUPT_APIC, true, + crit_offset); if (IS_ERR(soc_dts)) { err = PTR_ERR(soc_dts); return err; @@ -88,21 +89,7 @@ static int __init intel_soc_thermal_init } } - err = intel_soc_dts_iosf_add_read_only_critical_trip(soc_dts, - crit_offset); - if (err) - goto error_trips; - return 0; - -error_trips: - if (soc_dts_thres_irq) { - free_irq(soc_dts_thres_irq, soc_dts); - acpi_unregister_gsi(soc_dts_thres_gsi); - } - intel_soc_dts_iosf_exit(soc_dts); - - return err; } static void __exit intel_soc_thermal_exit(void)