From patchwork Mon Jan 23 18:40:33 2023 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: "Rafael J. Wysocki" X-Patchwork-Id: 47328 Return-Path: Delivered-To: ouuuleilei@gmail.com Received: by 2002:adf:eb09:0:0:0:0:0 with SMTP id s9csp1760989wrn; Mon, 23 Jan 2023 10:42:32 -0800 (PST) X-Google-Smtp-Source: AMrXdXtNq06z8i+SP0RXA/B2xbvX7/2TlPLr2Vsld6UhHJyVrbEogbZszHKqpN93cuFPOixu21XS X-Received: by 2002:a17:90a:d344:b0:229:ef6c:4139 with SMTP id i4-20020a17090ad34400b00229ef6c4139mr16427517pjx.22.1674499352296; Mon, 23 Jan 2023 10:42:32 -0800 (PST) ARC-Seal: i=1; a=rsa-sha256; t=1674499352; cv=none; d=google.com; s=arc-20160816; b=fRDvcvWTK/c7b3VejYZ7hMToWdVMpdnmI94V5wywOEhDmEFwUQboXBQv5YdquNgfEK /oBRKjqi0a4uLxMjY6MuhMES9RKO4mqsGUhqGGNl98bteL9HkkBctgGB0Gsu5T5ItBXX 3nsRgb44o2y7OFyXVLyW1Rwt6pLZ5II1WymSP5GpzBGFzS9ABCnNGvuNTQBCiYnptHxw GaSewND+dCnHEhOji0KKG7aRw5fl1XLpCyKF9iRPfMhgx67Zm0BHdBhYqEILZecAMgGQ KldvP3Jad7KUcRFS7xvdMG8zArDNDhoN1RlZSfPkhVgHZFEGhYTmiZ3IisZp0zlpp6O4 QSLQ== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816; h=list-id:precedence:content-transfer-encoding:mime-version :references:in-reply-to:message-id:date:subject:cc:to:from; bh=MEYgaqlfmwxjAZqjgzOaqKOr6AnnrNmrycDAmdP34/Y=; b=cpkHAkomGL/eV0N3a9CV9pcA4mlnNS466Ed64qbwSsIGqatTgx7MoP1FQHT4C5dUcR rc6VH/nGc+JBV1s+EML7Q3zMGZZtGHSLq9/QDH1zNbNBgZWi9ThKp3dflOZxVllHZjj7 No2p2x6ItZC4ziTQGcvplmYJrHZ4M3+5rVIY3romDJ0/s2fFnMlGMTfUJ6ebLCr69itY le/EdVORRdNoqoiWYh4E7TPGNUGachfIReAIFgnED/DLqq1ULceATg/CQa4b9ULX1WQ5 4X2pTR+aXod6cRC98OIIbmrphtKF+FUfb1uhxDeB5gutGYwSMPLhe88L3sYAzOQVbvAn 3v5A== ARC-Authentication-Results: i=1; mx.google.com; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::1:20 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Received: from out1.vger.email (out1.vger.email. [2620:137:e000::1:20]) by mx.google.com with ESMTP id h14-20020a17090aa88e00b00218de7c19efsi11614311pjq.108.2023.01.23.10.42.16; Mon, 23 Jan 2023 10:42:32 -0800 (PST) Received-SPF: pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::1:20 as permitted sender) client-ip=2620:137:e000::1:20; Authentication-Results: mx.google.com; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::1:20 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S231800AbjAWSlz (ORCPT + 99 others); Mon, 23 Jan 2023 13:41:55 -0500 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:52556 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S230205AbjAWSlv (ORCPT ); Mon, 23 Jan 2023 13:41:51 -0500 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id 7464826848; Mon, 23 Jan 2023 10:41:42 -0800 (PST) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.1.0) id 81a3920b434318b1; Mon, 23 Jan 2023 19:41:40 +0100 Received: from kreacher.localnet (unknown [213.134.188.170]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id 2267E213259F; Mon, 23 Jan 2023 19:41:40 +0100 (CET) From: "Rafael J. Wysocki" To: Linux PM , Srinivas Pandruvada Cc: LKML , Linux ACPI , Daniel Lezcano , Zhang Rui Subject: [PATCH v7 2/3] thermal: intel: intel_pch: Use generic trip points Date: Mon, 23 Jan 2023 19:40:33 +0100 Message-ID: <4790872.GXAFRqVoOG@kreacher> In-Reply-To: <5916342.lOV4Wx5bFT@kreacher> References: <5916342.lOV4Wx5bFT@kreacher> MIME-Version: 1.0 X-CLIENT-IP: 213.134.188.170 X-CLIENT-HOSTNAME: 213.134.188.170 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedvhedruddukedguddtgecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffogffrnfdpggftiffpkfenuceurghilhhouhhtmecuudehtdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvvefufffkjghfggfgtgesthfuredttddtjeenucfhrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqeenucggtffrrghtthgvrhhnpedvffeuiedtgfdvtddugeeujedtffetteegfeekffdvfedttddtuefhgeefvdejhfenucfkphepvddufedrudefgedrudekkedrudejtdenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpedvudefrddufeegrddukeekrddujedtpdhhvghlohepkhhrvggrtghhvghrrdhlohgtrghlnhgvthdpmhgrihhlfhhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqpdhnsggprhgtphhtthhopeeipdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtohepshhrihhnihhvrghsrdhprghnughruhhvrggurgeslhhinhhugidrihhnthgvlhdrtghomhdprhgtphhtthhopehlihhnuhigqdhkvghrnhgvlhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdgrtghpihesvhhgvghr rdhkvghrnhgvlhdrohhrghdprhgtphhtthhopegurghnihgvlhdrlhgviigtrghnoheslhhinhgrrhhordhorhhgpdhrtghpthhtoheprhhuihdriihhrghnghesihhnthgvlhdrtghomh X-DCC--Metrics: v370.home.net.pl 1024; Body=6 Fuz1=6 Fuz2=6 X-Spam-Status: No, score=-1.9 required=5.0 tests=BAYES_00,SPF_HELO_NONE, SPF_PASS autolearn=ham autolearn_force=no version=3.4.6 X-Spam-Checker-Version: SpamAssassin 3.4.6 (2021-04-09) on lindbergh.monkeyblade.net Precedence: bulk List-ID: X-Mailing-List: linux-kernel@vger.kernel.org X-getmail-retrieved-from-mailbox: =?utf-8?q?INBOX?= X-GMAIL-THRID: =?utf-8?q?1755839832811680986?= X-GMAIL-MSGID: =?utf-8?q?1755839832811680986?= From: Daniel Lezcano The thermal framework gives the possibility to register the trip points along with the thermal zone. When that is done, no get_trip_* callbacks are needed and they can be removed. Convert the existing callbacks content logic into generic trip points initialization code and register them along with the thermal zone. In order to consolidate the code, use an ACPI trip library function to populate a generic trip point. Signed-off-by: Daniel Lezcano Reviewed-by: Zhang Rui [ rjw: Subject and changelog edits, rebase ] Signed-off-by: Rafael J. Wysocki --- drivers/thermal/intel/Kconfig | 1 drivers/thermal/intel/intel_pch_thermal.c | 88 ++++++------------------------ 2 files changed, 20 insertions(+), 69 deletions(-) Index: linux-pm/drivers/thermal/intel/Kconfig =================================================================== --- linux-pm.orig/drivers/thermal/intel/Kconfig +++ linux-pm/drivers/thermal/intel/Kconfig @@ -81,6 +81,7 @@ config INTEL_BXT_PMIC_THERMAL config INTEL_PCH_THERMAL tristate "Intel PCH Thermal Reporting Driver" depends on X86 && PCI + select THERMAL_ACPI if ACPI help Enable this to support thermal reporting on certain intel PCHs. Thermal reporting device will provide temperature reading, Index: linux-pm/drivers/thermal/intel/intel_pch_thermal.c =================================================================== --- linux-pm.orig/drivers/thermal/intel/intel_pch_thermal.c +++ linux-pm/drivers/thermal/intel/intel_pch_thermal.c @@ -65,6 +65,8 @@ #define WPT_TEMP_OFFSET (PCH_TEMP_OFFSET * MILLIDEGREE_PER_DEGREE) #define GET_PCH_TEMP(x) (((x) / 2) + PCH_TEMP_OFFSET) +#define PCH_MAX_TRIPS 3 /* critical, hot, passive */ + /* Amount of time for each cooling delay, 100ms by default for now */ static unsigned int delay_timeout = 100; module_param(delay_timeout, int, 0644); @@ -82,12 +84,7 @@ struct pch_thermal_device { const struct pch_dev_ops *ops; struct pci_dev *pdev; struct thermal_zone_device *tzd; - int crt_trip_id; - unsigned long crt_temp; - int hot_trip_id; - unsigned long hot_temp; - int psv_trip_id; - unsigned long psv_temp; + struct thermal_trip trips[PCH_MAX_TRIPS]; bool bios_enabled; }; @@ -102,33 +99,22 @@ static void pch_wpt_add_acpi_psv_trip(st int *nr_trips) { struct acpi_device *adev; - - ptd->psv_trip_id = -1; + int ret; adev = ACPI_COMPANION(&ptd->pdev->dev); - if (adev) { - unsigned long long r; - acpi_status status; - - status = acpi_evaluate_integer(adev->handle, "_PSV", NULL, - &r); - if (ACPI_SUCCESS(status)) { - unsigned long trip_temp; - - trip_temp = deci_kelvin_to_millicelsius(r); - if (trip_temp) { - ptd->psv_temp = trip_temp; - ptd->psv_trip_id = *nr_trips; - ++(*nr_trips); - } - } - } + if (!adev) + return; + + ret = thermal_acpi_trip_passive(adev, &ptd->trips[*nr_trips]); + if (ret) + return; + + ++(*nr_trips); } #else static void pch_wpt_add_acpi_psv_trip(struct pch_thermal_device *ptd, int *nr_trips) { - ptd->psv_trip_id = -1; } #endif @@ -163,21 +149,19 @@ static int pch_wpt_init(struct pch_therm } read_trips: - ptd->crt_trip_id = -1; trip_temp = readw(ptd->hw_base + WPT_CTT); trip_temp &= 0x1FF; if (trip_temp) { - ptd->crt_temp = GET_WPT_TEMP(trip_temp); - ptd->crt_trip_id = 0; + ptd->trips[*nr_trips].temperature = GET_WPT_TEMP(trip_temp); + ptd->trips[*nr_trips].type = THERMAL_TRIP_CRITICAL; ++(*nr_trips); } - ptd->hot_trip_id = -1; trip_temp = readw(ptd->hw_base + WPT_PHL); trip_temp &= 0x1FF; if (trip_temp) { - ptd->hot_temp = GET_WPT_TEMP(trip_temp); - ptd->hot_trip_id = *nr_trips; + ptd->trips[*nr_trips].temperature = GET_WPT_TEMP(trip_temp); + ptd->trips[*nr_trips].type = THERMAL_TRIP_HOT; ++(*nr_trips); } @@ -298,39 +282,6 @@ static int pch_thermal_get_temp(struct t return ptd->ops->get_temp(ptd, temp); } -static int pch_get_trip_type(struct thermal_zone_device *tzd, int trip, - enum thermal_trip_type *type) -{ - struct pch_thermal_device *ptd = tzd->devdata; - - if (ptd->crt_trip_id == trip) - *type = THERMAL_TRIP_CRITICAL; - else if (ptd->hot_trip_id == trip) - *type = THERMAL_TRIP_HOT; - else if (ptd->psv_trip_id == trip) - *type = THERMAL_TRIP_PASSIVE; - else - return -EINVAL; - - return 0; -} - -static int pch_get_trip_temp(struct thermal_zone_device *tzd, int trip, int *temp) -{ - struct pch_thermal_device *ptd = tzd->devdata; - - if (ptd->crt_trip_id == trip) - *temp = ptd->crt_temp; - else if (ptd->hot_trip_id == trip) - *temp = ptd->hot_temp; - else if (ptd->psv_trip_id == trip) - *temp = ptd->psv_temp; - else - return -EINVAL; - - return 0; -} - static void pch_critical(struct thermal_zone_device *tzd) { dev_dbg(&tzd->device, "%s: critical temperature reached\n", tzd->type); @@ -338,8 +289,6 @@ static void pch_critical(struct thermal_ static struct thermal_zone_device_ops tzd_ops = { .get_temp = pch_thermal_get_temp, - .get_trip_type = pch_get_trip_type, - .get_trip_temp = pch_get_trip_temp, .critical = pch_critical, }; @@ -423,8 +372,9 @@ static int intel_pch_thermal_probe(struc if (err) goto error_cleanup; - ptd->tzd = thermal_zone_device_register(bi->name, nr_trips, 0, ptd, - &tzd_ops, NULL, 0, 0); + ptd->tzd = thermal_zone_device_register_with_trips(bi->name, ptd->trips, + nr_trips, 0, ptd, + &tzd_ops, NULL, 0, 0); if (IS_ERR(ptd->tzd)) { dev_err(&pdev->dev, "Failed to register thermal zone %s\n", bi->name);