From patchwork Thu Nov 30 18:37:45 2023 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: "Rafael J. Wysocki" X-Patchwork-Id: 172041 Return-Path: Delivered-To: ouuuleilei@gmail.com Received: by 2002:a59:bcd1:0:b0:403:3b70:6f57 with SMTP id r17csp599638vqy; Thu, 30 Nov 2023 10:38:26 -0800 (PST) X-Google-Smtp-Source: AGHT+IFVVh7VTMC8VT31wDJgl+f9Mf4J7Bq2bGjkUomvdPFbpW4J8jQfut+Als45fNsEFyNbWip9 X-Received: by 2002:a05:6a00:1888:b0:6cd:daa5:1398 with SMTP id x8-20020a056a00188800b006cddaa51398mr6535991pfh.9.1701369506155; Thu, 30 Nov 2023 10:38:26 -0800 (PST) ARC-Seal: i=1; a=rsa-sha256; t=1701369506; cv=none; d=google.com; s=arc-20160816; b=u7hl8Wn/t18GEDEpu6SXwgPvUexlC30p/jlEbauNi7/on3azQzUm1AmsOaaC5zU1e7 rkaJO1RR8+7ahVqRakIpY899DkeMkDbxIrIBVYV0MGvv8JxsA0tBdd9dZChuVxlMxYxY L0NCIP0wdsrPMvb66yJfOKoIFV2GYp0kBieofkQwAYOKSrJ8bVtFowXy5ZzGKysUrQvc w/3fhIHqJWHdLhJGJLRWXc7IM1Bz0JDH0SWdo89IE36rLUHuvnjeYVS1UAbzVMsqt9i7 SYxBITAE5aXKZ+DS8bRDByL6Gj2bdxPliJ16CD0MltU8BDtTQw175Xuy3Ex4Xqk6WbRM TcNg== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816; h=list-id:precedence:content-transfer-encoding:mime-version :references:in-reply-to:message-id:date:subject:cc:to:from; bh=qUF5Fz2/vEEaSXCrps3zFf0wRvtSgIThdRgzSgqtCqs=; fh=nLypB3rvk504GacFIka1NRIrs+dxk/mQtlixTJ9Bzjw=; b=zHiUOZaqN0v6Td6wWU1rAJORYFlcXHCLbdb04wZkYOVjNFuS9zd6KKH5gtbdyZ91rY CtH4FJQlTM2PqcUut4ecxkYUUp0++H7ixYSaroF/pbluK6fmH1joVqXXiX+n9sp3NP0n 3uNUmzOK+NfAwNe353UWT+tipxdkB9fu97Vy39EYUXhFZPHv/itDlDQ52k5kxX0XYooa YegFY1l8Mt+zVYTcKNpbe5l3EZgSOZaoF5n12/sINLDZ8ZY5OFWmezdQcIWmzsNZaXT3 Y6rwPqMobanlYCuI0Sh1aRiSlOyLht2RR0JZM0CWmY8yarq3UKfQ3vtxloBiT3OhBHkg Yxfw== ARC-Authentication-Results: i=1; mx.google.com; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 23.128.96.31 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Received: from morse.vger.email (morse.vger.email. [23.128.96.31]) by mx.google.com with ESMTPS id y64-20020a636443000000b005c200f02d9asi1910663pgb.621.2023.11.30.10.38.25 (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Thu, 30 Nov 2023 10:38:26 -0800 (PST) Received-SPF: pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 23.128.96.31 as permitted sender) client-ip=23.128.96.31; Authentication-Results: mx.google.com; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 23.128.96.31 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Received: from out1.vger.email (depot.vger.email [IPv6:2620:137:e000::3:0]) by morse.vger.email (Postfix) with ESMTP id 8E4F282E2943; Thu, 30 Nov 2023 10:38:23 -0800 (PST) X-Virus-Status: Clean X-Virus-Scanned: clamav-milter 0.103.11 at morse.vger.email Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S1346612AbjK3SiC (ORCPT + 99 others); Thu, 30 Nov 2023 13:38:02 -0500 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:41210 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S232274AbjK3Sh5 (ORCPT ); Thu, 30 Nov 2023 13:37:57 -0500 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id 299FE10E5; Thu, 30 Nov 2023 10:38:02 -0800 (PST) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.4.0) id 1d4465a859ae4881; Thu, 30 Nov 2023 19:38:00 +0100 Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by cloudserver094114.home.pl (Postfix) with ESMTPSA id 61FA366862D; Thu, 30 Nov 2023 19:38:00 +0100 (CET) From: "Rafael J. Wysocki" To: Daniel Lezcano , Lukasz Luba Cc: Linux PM , LKML , Srinivas Pandruvada , Zhang Rui Subject: [PATCH v1 2/2] thermal: sysfs: Eliminate unnecessary zone locking Date: Thu, 30 Nov 2023 19:37:45 +0100 Message-ID: <2933888.e9J7NaK4W3@kreacher> In-Reply-To: <5754079.DvuYhMxLoT@kreacher> References: <5754079.DvuYhMxLoT@kreacher> MIME-Version: 1.0 X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedvkedrudeijedguddugecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffogffrnfdpggftiffpkfenuceurghilhhouhhtmecuudehtdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvvefufffkjghfggfgtgesthfuredttddtjeenucfhrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqeenucggtffrrghtthgvrhhnpedvffeuiedtgfdvtddugeeujedtffetteegfeekffdvfedttddtuefhgeefvdejhfenucfkphepudelhedrudefiedrudelrdelgeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpeduleehrddufeeirdduledrleegpdhhvghlohepkhhrvggrtghhvghrrdhlohgtrghlnhgvthdpmhgrihhlfhhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqpdhnsggprhgtphhtthhopeeipdhrtghpthhtohepuggrnhhivghlrdhlvgiitggrnhhosehlihhnrghrohdrohhrghdprhgtphhtthhopehluhhkrghsiidrlhhusggrsegrrhhmrdgtohhmpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtohepshhr ihhnihhvrghsrdhprghnughruhhvrggurgeslhhinhhugidrihhnthgvlhdrtghomhdprhgtphhtthhopehruhhirdiihhgrnhhgsehinhhtvghlrdgtohhm X-DCC--Metrics: v370.home.net.pl 1024; Body=6 Fuz1=6 Fuz2=6 X-Spam-Status: No, score=-0.8 required=5.0 tests=HEADER_FROM_DIFFERENT_DOMAINS, MAILING_LIST_MULTI,SPF_HELO_NONE,SPF_PASS,T_SCC_BODY_TEXT_LINE autolearn=unavailable autolearn_force=no version=3.4.6 X-Spam-Checker-Version: SpamAssassin 3.4.6 (2021-04-09) on morse.vger.email Precedence: bulk List-ID: X-Mailing-List: linux-kernel@vger.kernel.org X-Greylist: Sender passed SPF test, not delayed by milter-greylist-4.6.4 (morse.vger.email [0.0.0.0]); Thu, 30 Nov 2023 10:38:23 -0800 (PST) X-getmail-retrieved-from-mailbox: INBOX X-GMAIL-THRID: 1784015231086776226 X-GMAIL-MSGID: 1784015231086776226 From: Rafael J. Wysocki The _show() callback functions of the trip point sysfs attributes, temperature, hysteresis and type, need not use thermal zone locking, because the layout of the data structures they access does not change after the thermal zone registration. Namely, they all need to access a specific entry in the thermal zone's trips[] table that is always present for non-tripless thermal zones and its size cannot change after the thermal zone has been registered. Thus it is always safe to access the trips[] table of a registered thermal zone from each of the sysfs attributes in question. Moreover, the type of a trip point does not change after registering its thermal zone, and while its temperature and hysteresis can change, for example due to a firmware-induced thermal zone update, holding the zone lock around reading them is pointless, because it does not prevent stale values from being returned to user space. For example, a trip point temperature can always change ater trip_point_temp_show() has read it and before the function's return statement is executed, regardless of whether or not zone locking is used. For this reason, drop the zone locking from trip_point_type_show(), trip_point_temp_show(), and trip_point_hyst_show(). Signed-off-by: Rafael J. Wysocki --- drivers/thermal/thermal_sysfs.c | 60 ++++++++++++++-------------------------- 1 file changed, 21 insertions(+), 39 deletions(-) Index: linux-pm/drivers/thermal/thermal_sysfs.c =================================================================== --- linux-pm.orig/drivers/thermal/thermal_sysfs.c +++ linux-pm/drivers/thermal/thermal_sysfs.c @@ -83,25 +83,18 @@ trip_point_type_show(struct device *dev, char *buf) { struct thermal_zone_device *tz = to_thermal_zone(dev); - struct thermal_trip trip; - int trip_id, result; + int trip_id; + + if (!device_is_registered(dev)) + return -ENODEV; if (sscanf(attr->attr.name, "trip_point_%d_type", &trip_id) != 1) return -EINVAL; - mutex_lock(&tz->lock); - - if (device_is_registered(dev)) - result = __thermal_zone_get_trip(tz, trip_id, &trip); - else - result = -ENODEV; - - mutex_unlock(&tz->lock); - - if (result) - return result; + if (trip_id < 0 || trip_id > tz->num_trips) + return -EINVAL; - switch (trip.type) { + switch (tz->trips[trip_id].type) { case THERMAL_TRIP_CRITICAL: return sprintf(buf, "critical\n"); case THERMAL_TRIP_HOT: @@ -164,25 +157,18 @@ trip_point_temp_show(struct device *dev, char *buf) { struct thermal_zone_device *tz = to_thermal_zone(dev); - struct thermal_trip trip; - int trip_id, ret; + int trip_id; + + if (!device_is_registered(dev)) + return -ENODEV; if (sscanf(attr->attr.name, "trip_point_%d_temp", &trip_id) != 1) return -EINVAL; - mutex_lock(&tz->lock); - - if (device_is_registered(dev)) - ret = __thermal_zone_get_trip(tz, trip_id, &trip); - else - ret = -ENODEV; - - mutex_unlock(&tz->lock); - - if (ret) - return ret; + if (trip_id < 0 || trip_id > tz->num_trips) + return -EINVAL; - return sprintf(buf, "%d\n", trip.temperature); + return sprintf(buf, "%d\n", tz->trips[trip_id].temperature); } static ssize_t @@ -234,22 +220,18 @@ trip_point_hyst_show(struct device *dev, char *buf) { struct thermal_zone_device *tz = to_thermal_zone(dev); - struct thermal_trip trip; - int trip_id, ret; + int trip_id; + + if (!device_is_registered(dev)) + return -ENODEV; if (sscanf(attr->attr.name, "trip_point_%d_hyst", &trip_id) != 1) return -EINVAL; - mutex_lock(&tz->lock); - - if (device_is_registered(dev)) - ret = __thermal_zone_get_trip(tz, trip_id, &trip); - else - ret = -ENODEV; - - mutex_unlock(&tz->lock); + if (trip_id < 0 || trip_id > tz->num_trips) + return -EINVAL; - return ret ? ret : sprintf(buf, "%d\n", trip.hysteresis); + return sprintf(buf, "%d\n", tz->trips[trip_id].hysteresis); } static ssize_t