From patchwork Mon Jan 23 18:41:23 2023 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: "Rafael J. Wysocki" X-Patchwork-Id: 47327 Return-Path: Delivered-To: ouuuleilei@gmail.com Received: by 2002:adf:eb09:0:0:0:0:0 with SMTP id s9csp1760917wrn; Mon, 23 Jan 2023 10:42:24 -0800 (PST) X-Google-Smtp-Source: AMrXdXuCz4X7Y/MDDARgS8BX8xhDNubmG26O4iS6vQ+5EHFHSE+m/wrERraqZNm4f0lS2d9Ipea3 X-Received: by 2002:a17:902:b704:b0:192:bbe9:4cab with SMTP id d4-20020a170902b70400b00192bbe94cabmr23631727pls.24.1674499343831; Mon, 23 Jan 2023 10:42:23 -0800 (PST) ARC-Seal: i=1; a=rsa-sha256; t=1674499343; cv=none; d=google.com; s=arc-20160816; b=N2kagdfjjaaAvGBemFPGa7dJpGggR4hlcQcKmNKn9O4Y+VrRapx4lTeNgigs+C+axh i4kZYGq546OdLSpojnVlj0cKYqKAcLt/R0m8/xo1Fkbli2mv3rEIPlA5pvKBul1itPR6 sLBEjaJ4koR27FmeNOYgOAL15gSMJt1Rx8l0eiZo3eqX5rwZ0n/5prcWNUXzwn+/V9bx daa3dFbAMAqCu7JgbMwayyatDSNcfI4MJuQt0jg65hxQkJ7JwTQaFA6riLgyqPbHXeFl B9nYXmV7gAit0u0+ctbnJpVRgaA/BMhxPTFFOk1hBF1Dvbib+B1JvQUYy0o+FramfDfA 77gA== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816; h=list-id:precedence:content-transfer-encoding:mime-version :references:in-reply-to:message-id:date:subject:cc:to:from; bh=CpI+vCp1N49HopakCFJrMjxeGNQiwkn1A6swOgxhp+0=; b=O8u1/HPz0hchEB+sjIOcEHxndkgJi+b5mgHmV8Lh2R87Y7VpwNS6J7EqVlgqkCxUNL Zou3WoXx54dXfonslTuO2+OSTnDajCethT4CzQ/nIyovsLikkgn/qat2czuhSM8qkJa2 P+xEEqSVKeM6j8lpCHTmKQdthTVe91XN+1fC242wvmXpMg0Nko9WSRoC1DGfYvfxB30D oHzrChjx+VJXwI0DOr2EshteXwr68fEFdjadwiQzvYNO47rK7rX8vjwkPbN8nSmUAWwA MU4byJJA9v165g08WEJdUaS1yzT5Lii5mX+xe0N+BpweKxY23OPH4/n6BFoBfVBTkXDl bmrA== ARC-Authentication-Results: i=1; mx.google.com; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::1:20 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Received: from out1.vger.email (out1.vger.email. [2620:137:e000::1:20]) by mx.google.com with ESMTP id j6-20020a17090276c600b00189ccadd447si91114plt.101.2023.01.23.10.42.12; Mon, 23 Jan 2023 10:42:23 -0800 (PST) Received-SPF: pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::1:20 as permitted sender) client-ip=2620:137:e000::1:20; Authentication-Results: mx.google.com; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::1:20 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S230129AbjAWSlw (ORCPT + 99 others); Mon, 23 Jan 2023 13:41:52 -0500 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:52538 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S231441AbjAWSlu (ORCPT ); Mon, 23 Jan 2023 13:41:50 -0500 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id 8314023311; Mon, 23 Jan 2023 10:41:41 -0800 (PST) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.1.0) id b7ed5d2300cc4e90; Mon, 23 Jan 2023 19:41:39 +0100 Received: from kreacher.localnet (unknown [213.134.188.170]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id B97AF213259F; Mon, 23 Jan 2023 19:41:38 +0100 (CET) From: "Rafael J. Wysocki" To: Linux PM , Srinivas Pandruvada Cc: LKML , Linux ACPI , Daniel Lezcano , Zhang Rui Subject: [PATCH v7 3/3] thermal: intel: int340x: Use generic trip points Date: Mon, 23 Jan 2023 19:41:23 +0100 Message-ID: <2147918.irdbgypaU6@kreacher> In-Reply-To: <5916342.lOV4Wx5bFT@kreacher> References: <5916342.lOV4Wx5bFT@kreacher> MIME-Version: 1.0 X-CLIENT-IP: 213.134.188.170 X-CLIENT-HOSTNAME: 213.134.188.170 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedvhedruddukedguddtgecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffogffrnfdpggftiffpkfenuceurghilhhouhhtmecuudehtdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvvefufffkjghfggfgtgesthfuredttddtjeenucfhrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqeenucggtffrrghtthgvrhhnpedvffeuiedtgfdvtddugeeujedtffetteegfeekffdvfedttddtuefhgeefvdejhfenucfkphepvddufedrudefgedrudekkedrudejtdenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpedvudefrddufeegrddukeekrddujedtpdhhvghlohepkhhrvggrtghhvghrrdhlohgtrghlnhgvthdpmhgrihhlfhhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqpdhnsggprhgtphhtthhopeeipdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtohepshhrihhnihhvrghsrdhprghnughruhhvrggurgeslhhinhhugidrihhnthgvlhdrtghomhdprhgtphhtthhopehlihhnuhigqdhkvghrnhgvlhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdgrtghpihesvhhgvghr rdhkvghrnhgvlhdrohhrghdprhgtphhtthhopegurghnihgvlhdrlhgviigtrghnoheslhhinhgrrhhordhorhhgpdhrtghpthhtoheprhhuihdriihhrghnghesihhnthgvlhdrtghomh X-DCC--Metrics: v370.home.net.pl 1024; Body=6 Fuz1=6 Fuz2=6 X-Spam-Status: No, score=-1.9 required=5.0 tests=BAYES_00,SPF_HELO_NONE, SPF_PASS autolearn=ham autolearn_force=no version=3.4.6 X-Spam-Checker-Version: SpamAssassin 3.4.6 (2021-04-09) on lindbergh.monkeyblade.net Precedence: bulk List-ID: X-Mailing-List: linux-kernel@vger.kernel.org X-getmail-retrieved-from-mailbox: =?utf-8?q?INBOX?= X-GMAIL-THRID: =?utf-8?q?1755839823802937269?= X-GMAIL-MSGID: =?utf-8?q?1755839823802937269?= From: Daniel Lezcano The thermal framework gives the possibility to register the trip points along with the thermal zone. When that is done, no get_trip_* callbacks are needed and they can be removed. Convert the existing callbacks content logic into generic trip points initialization code and register them along with the thermal zone. In order to consolidate the code, use ACPI trip library functions to populate generic trip points. Signed-off-by: Daniel Lezcano Reviewed-by: Zhang Rui [ rjw: Subject and changelog edits, rebase ] Signed-off-by: Rafael J. Wysocki --- drivers/thermal/intel/int340x_thermal/Kconfig | 1 drivers/thermal/intel/int340x_thermal/int340x_thermal_zone.c | 172 ++--------- drivers/thermal/intel/int340x_thermal/int340x_thermal_zone.h | 10 3 files changed, 48 insertions(+), 135 deletions(-) Index: linux-pm/drivers/thermal/intel/int340x_thermal/Kconfig =================================================================== --- linux-pm.orig/drivers/thermal/intel/int340x_thermal/Kconfig +++ linux-pm/drivers/thermal/intel/int340x_thermal/Kconfig @@ -9,6 +9,7 @@ config INT340X_THERMAL select THERMAL_GOV_USER_SPACE select ACPI_THERMAL_REL select ACPI_FAN + select THERMAL_ACPI select INTEL_SOC_DTS_IOSF_CORE select INTEL_TCC select PROC_THERMAL_MMIO_RAPL if POWERCAP Index: linux-pm/drivers/thermal/intel/int340x_thermal/int340x_thermal_zone.c =================================================================== --- linux-pm.orig/drivers/thermal/intel/int340x_thermal/int340x_thermal_zone.c +++ linux-pm/drivers/thermal/intel/int340x_thermal/int340x_thermal_zone.c @@ -37,65 +37,6 @@ static int int340x_thermal_get_zone_temp return 0; } -static int int340x_thermal_get_trip_temp(struct thermal_zone_device *zone, - int trip, int *temp) -{ - struct int34x_thermal_zone *d = zone->devdata; - int i; - - if (trip < d->aux_trip_nr) - *temp = d->aux_trips[trip]; - else if (trip == d->crt_trip_id) - *temp = d->crt_temp; - else if (trip == d->psv_trip_id) - *temp = d->psv_temp; - else if (trip == d->hot_trip_id) - *temp = d->hot_temp; - else { - for (i = 0; i < INT340X_THERMAL_MAX_ACT_TRIP_COUNT; i++) { - if (d->act_trips[i].valid && - d->act_trips[i].id == trip) { - *temp = d->act_trips[i].temp; - break; - } - } - if (i == INT340X_THERMAL_MAX_ACT_TRIP_COUNT) - return -EINVAL; - } - - return 0; -} - -static int int340x_thermal_get_trip_type(struct thermal_zone_device *zone, - int trip, - enum thermal_trip_type *type) -{ - struct int34x_thermal_zone *d = zone->devdata; - int i; - - if (trip < d->aux_trip_nr) - *type = THERMAL_TRIP_PASSIVE; - else if (trip == d->crt_trip_id) - *type = THERMAL_TRIP_CRITICAL; - else if (trip == d->hot_trip_id) - *type = THERMAL_TRIP_HOT; - else if (trip == d->psv_trip_id) - *type = THERMAL_TRIP_PASSIVE; - else { - for (i = 0; i < INT340X_THERMAL_MAX_ACT_TRIP_COUNT; i++) { - if (d->act_trips[i].valid && - d->act_trips[i].id == trip) { - *type = THERMAL_TRIP_ACTIVE; - break; - } - } - if (i == INT340X_THERMAL_MAX_ACT_TRIP_COUNT) - return -EINVAL; - } - - return 0; -} - static int int340x_thermal_set_trip_temp(struct thermal_zone_device *zone, int trip, int temp) { @@ -109,20 +50,15 @@ static int int340x_thermal_set_trip_temp if (ACPI_FAILURE(status)) return -EIO; - d->aux_trips[trip] = temp; - return 0; } - -static int int340x_thermal_get_trip_hyst(struct thermal_zone_device *zone, - int trip, int *temp) +static int int340x_thermal_get_global_hyst(struct acpi_device *adev, int *temp) { - struct int34x_thermal_zone *d = zone->devdata; acpi_status status; unsigned long long hyst; - status = acpi_evaluate_integer(d->adev->handle, "GTSH", NULL, &hyst); + status = acpi_evaluate_integer(adev->handle, "GTSH", NULL, &hyst); if (ACPI_FAILURE(status)) *temp = 0; else @@ -131,6 +67,7 @@ static int int340x_thermal_get_trip_hyst return 0; } + static void int340x_thermal_critical(struct thermal_zone_device *zone) { dev_dbg(&zone->device, "%s: critical temperature reached\n", zone->type); @@ -138,58 +75,36 @@ static void int340x_thermal_critical(str static struct thermal_zone_device_ops int340x_thermal_zone_ops = { .get_temp = int340x_thermal_get_zone_temp, - .get_trip_temp = int340x_thermal_get_trip_temp, - .get_trip_type = int340x_thermal_get_trip_type, .set_trip_temp = int340x_thermal_set_trip_temp, - .get_trip_hyst = int340x_thermal_get_trip_hyst, .critical = int340x_thermal_critical, }; -static int int340x_thermal_get_trip_config(acpi_handle handle, char *name, - int *temp) -{ - unsigned long long r; - acpi_status status; - - status = acpi_evaluate_integer(handle, name, NULL, &r); - if (ACPI_FAILURE(status)) - return -EIO; - - *temp = deci_kelvin_to_millicelsius(r); - - return 0; -} - int int340x_thermal_read_trips(struct int34x_thermal_zone *int34x_zone) { - int trip_cnt = int34x_zone->aux_trip_nr; - int i; + int trip_cnt; + int i, ret; - int34x_zone->crt_trip_id = -1; - if (!int340x_thermal_get_trip_config(int34x_zone->adev->handle, "_CRT", - &int34x_zone->crt_temp)) - int34x_zone->crt_trip_id = trip_cnt++; - - int34x_zone->hot_trip_id = -1; - if (!int340x_thermal_get_trip_config(int34x_zone->adev->handle, "_HOT", - &int34x_zone->hot_temp)) - int34x_zone->hot_trip_id = trip_cnt++; - - int34x_zone->psv_trip_id = -1; - if (!int340x_thermal_get_trip_config(int34x_zone->adev->handle, "_PSV", - &int34x_zone->psv_temp)) - int34x_zone->psv_trip_id = trip_cnt++; + trip_cnt = int34x_zone->aux_trip_nr; + + ret = thermal_acpi_trip_critical(int34x_zone->adev, &int34x_zone->trips[trip_cnt]); + if (!ret) + trip_cnt++; + + ret = thermal_acpi_trip_hot(int34x_zone->adev, &int34x_zone->trips[trip_cnt]); + if (!ret) + trip_cnt++; + + ret = thermal_acpi_trip_passive(int34x_zone->adev, &int34x_zone->trips[trip_cnt]); + if (!ret) + trip_cnt++; for (i = 0; i < INT340X_THERMAL_MAX_ACT_TRIP_COUNT; i++) { - char name[5] = { '_', 'A', 'C', '0' + i, '\0' }; - if (int340x_thermal_get_trip_config(int34x_zone->adev->handle, - name, - &int34x_zone->act_trips[i].temp)) + ret = thermal_acpi_trip_active(int34x_zone->adev, i, &int34x_zone->trips[trip_cnt]); + if (ret) break; - int34x_zone->act_trips[i].id = trip_cnt++; - int34x_zone->act_trips[i].valid = true; + trip_cnt++; } return trip_cnt; @@ -208,7 +123,7 @@ struct int34x_thermal_zone *int340x_ther acpi_status status; unsigned long long trip_cnt; int trip_mask = 0; - int ret; + int i, ret; int34x_thermal_zone = kzalloc(sizeof(*int34x_thermal_zone), GFP_KERNEL); @@ -228,32 +143,35 @@ struct int34x_thermal_zone *int340x_ther int34x_thermal_zone->ops->get_temp = get_temp; status = acpi_evaluate_integer(adev->handle, "PATC", NULL, &trip_cnt); - if (ACPI_FAILURE(status)) - trip_cnt = 0; - else { - int i; - - int34x_thermal_zone->aux_trips = - kcalloc(trip_cnt, - sizeof(*int34x_thermal_zone->aux_trips), - GFP_KERNEL); - if (!int34x_thermal_zone->aux_trips) { - ret = -ENOMEM; - goto err_trip_alloc; - } - trip_mask = BIT(trip_cnt) - 1; + if (!ACPI_FAILURE(status)) { int34x_thermal_zone->aux_trip_nr = trip_cnt; - for (i = 0; i < trip_cnt; ++i) - int34x_thermal_zone->aux_trips[i] = THERMAL_TEMP_INVALID; + trip_mask = BIT(trip_cnt) - 1; + } + + int34x_thermal_zone->trips = kzalloc(sizeof(*int34x_thermal_zone->trips) * + (INT340X_THERMAL_MAX_TRIP_COUNT + trip_cnt), + GFP_KERNEL); + if (!int34x_thermal_zone->trips) { + ret = -ENOMEM; + goto err_trips_alloc; } trip_cnt = int340x_thermal_read_trips(int34x_thermal_zone); + for (i = 0; i < trip_cnt; ++i) + int340x_thermal_get_global_hyst(adev, &int34x_thermal_zone->trips[i].hysteresis); + + for (i = 0; i < int34x_thermal_zone->aux_trip_nr; i++) { + int34x_thermal_zone->trips[i].type = THERMAL_TRIP_PASSIVE; + int34x_thermal_zone->trips[i].temperature = THERMAL_TEMP_INVALID; + } + int34x_thermal_zone->lpat_table = acpi_lpat_get_conversion_table( adev->handle); - int34x_thermal_zone->zone = thermal_zone_device_register( + int34x_thermal_zone->zone = thermal_zone_device_register_with_trips( acpi_device_bid(adev), + int34x_thermal_zone->trips, trip_cnt, trip_mask, int34x_thermal_zone, int34x_thermal_zone->ops, @@ -272,9 +190,9 @@ struct int34x_thermal_zone *int340x_ther err_enable: thermal_zone_device_unregister(int34x_thermal_zone->zone); err_thermal_zone: + kfree(int34x_thermal_zone->trips); acpi_lpat_free_conversion_table(int34x_thermal_zone->lpat_table); - kfree(int34x_thermal_zone->aux_trips); -err_trip_alloc: +err_trips_alloc: kfree(int34x_thermal_zone->ops); err_ops_alloc: kfree(int34x_thermal_zone); @@ -287,7 +205,7 @@ void int340x_thermal_zone_remove(struct { thermal_zone_device_unregister(int34x_thermal_zone->zone); acpi_lpat_free_conversion_table(int34x_thermal_zone->lpat_table); - kfree(int34x_thermal_zone->aux_trips); + kfree(int34x_thermal_zone->trips); kfree(int34x_thermal_zone->ops); kfree(int34x_thermal_zone); } Index: linux-pm/drivers/thermal/intel/int340x_thermal/int340x_thermal_zone.h =================================================================== --- linux-pm.orig/drivers/thermal/intel/int340x_thermal/int340x_thermal_zone.h +++ linux-pm/drivers/thermal/intel/int340x_thermal/int340x_thermal_zone.h @@ -10,6 +10,7 @@ #include #define INT340X_THERMAL_MAX_ACT_TRIP_COUNT 10 +#define INT340X_THERMAL_MAX_TRIP_COUNT INT340X_THERMAL_MAX_ACT_TRIP_COUNT + 3 struct active_trip { int temp; @@ -19,15 +20,8 @@ struct active_trip { struct int34x_thermal_zone { struct acpi_device *adev; - struct active_trip act_trips[INT340X_THERMAL_MAX_ACT_TRIP_COUNT]; - unsigned long *aux_trips; + struct thermal_trip *trips; int aux_trip_nr; - int psv_temp; - int psv_trip_id; - int crt_temp; - int crt_trip_id; - int hot_temp; - int hot_trip_id; struct thermal_zone_device *zone; struct thermal_zone_device_ops *ops; void *priv_data;