| Message ID | 5916342.lOV4Wx5bFT@kreacher |
|---|---|
| Headers |
Return-Path: <linux-kernel-owner@vger.kernel.org>
Delivered-To: ouuuleilei@gmail.com
Received: by 2002:adf:eb09:0:0:0:0:0 with SMTP id s9csp1766859wrn;
Mon, 23 Jan 2023 10:59:28 -0800 (PST)
X-Google-Smtp-Source:
AMrXdXur5Mk5lmESoISC+JYFN7ht5hZAMTdI4Syv6NaIxtJtNZg88wSblug83hQT/twP1gPWO3Zs
X-Received: by 2002:aa7:cf92:0:b0:48b:58be:472c with SMTP id
z18-20020aa7cf92000000b0048b58be472cmr27273597edx.18.1674500368823;
Mon, 23 Jan 2023 10:59:28 -0800 (PST)
ARC-Seal: i=1; a=rsa-sha256; t=1674500368; cv=none;
d=google.com; s=arc-20160816;
b=S7cFsA7i+6j7G9BT6KEA5HZHQAVeda9qdKr+QLGFk0/TgpNrYwiji+MQRzB0Mm0TCe
2lvR/lhAEy0nxr3YRfoYIhig04BS3FtJnF7dZcsViWNYcydb156kqMxD9Q+iMOm3x58e
XcRSPlgfQTgW6WEDg9Uf06K6RJSWX/s2rnnJS8s70lsHKYNmHND76mwOIlUVRqhD2Z8i
FhGtti4jb7As4itVJL/4uGFiEbO5niprepWcuxSsh/YDTrN9SNm2m2MGdtwAImGyGtCI
zqPLv6VL3RafN15C16PD7mtq+F+vA7CZtuPf4TNv57lHjTYWdQ2awE3c68EulG1Yau1t
MjNw==
ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com;
s=arc-20160816;
h=list-id:precedence:content-transfer-encoding:mime-version
:message-id:date:subject:cc:to:from;
bh=D2KU16XmiOOHTxJx6snCbvGqtKzx36fyXlvYM0iAx9E=;
b=jfDoDqsgNlkK8GMKHKKKvAS00nZQsRHrdfrf9FdEczTUg47js4eh3zMC+If2kANjOb
epp4728z3JG9HPoZ0pMZcoP8+T43pr07S5iSP2cuGNQ2WKqC1X3scJCzow9328FlPkkB
9rV2gZYYuiO5xZCt51yQgWOGSk2RribytEPHPPmHNRSzj3cZxrSVHs6YV+Rok/sAkzAO
ClRn9QZPzvx7b4XcTESSLG9tTx8pPaIeFeNejGvCPyDz+McDu6PEJaUJmem5eEjCGS47
yvvXjwG/lMrcP7Yzrg4ihtI3cLaK+9QUV5eUx6YketlBv258mk/0a9fsIyQsuubvvGwB
gCPg==
ARC-Authentication-Results: i=1; mx.google.com;
spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org
designates 2620:137:e000::1:20 as permitted sender)
smtp.mailfrom=linux-kernel-owner@vger.kernel.org
Received: from out1.vger.email (out1.vger.email. [2620:137:e000::1:20])
by mx.google.com with ESMTP id
b91-20020a509f64000000b0049e190b68f1si137240edf.499.2023.01.23.10.59.03;
Mon, 23 Jan 2023 10:59:28 -0800 (PST)
Received-SPF: pass (google.com: domain of linux-kernel-owner@vger.kernel.org
designates 2620:137:e000::1:20 as permitted sender)
client-ip=2620:137:e000::1:20;
Authentication-Results: mx.google.com;
spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org
designates 2620:137:e000::1:20 as permitted sender)
smtp.mailfrom=linux-kernel-owner@vger.kernel.org
Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand
id S231791AbjAWSmL (ORCPT <rfc822;rust.linux@gmail.com> + 99 others);
Mon, 23 Jan 2023 13:42:11 -0500
Received: from lindbergh.monkeyblade.net ([23.128.96.19]:53134 "EHLO
lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org
with ESMTP id S231624AbjAWSmH (ORCPT
<rfc822;linux-kernel@vger.kernel.org>);
Mon, 23 Jan 2023 13:42:07 -0500
Received: from cloudserver094114.home.pl (cloudserver094114.home.pl
[79.96.170.134])
by lindbergh.monkeyblade.net (Postfix) with ESMTPS id 895BE2CFFC;
Mon, 23 Jan 2023 10:41:45 -0800 (PST)
Received: from localhost (127.0.0.1) (HELO v370.home.net.pl)
by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with
SMTP (IdeaSmtpServer 5.1.0)
id aea66656563a992a; Mon, 23 Jan 2023 19:41:43 +0100
Received: from kreacher.localnet (unknown [213.134.188.170])
(using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits)
key-exchange X25519 server-signature RSA-PSS (2048 bits)
server-digest SHA256)
(No client certificate requested)
by v370.home.net.pl (Postfix) with ESMTPSA id 32D0A21325FF;
Mon, 23 Jan 2023 19:41:43 +0100 (CET)
From: "Rafael J. Wysocki" <rjw@rjwysocki.net>
To: Linux PM <linux-pm@vger.kernel.org>,
Srinivas Pandruvada <srinivas.pandruvada@linux.intel.com>
Cc: LKML <linux-kernel@vger.kernel.org>,
Linux ACPI <linux-acpi@vger.kernel.org>,
Daniel Lezcano <daniel.lezcano@linaro.org>,
Zhang Rui <rui.zhang@intel.com>
Subject: [PATCH v7 0/3] thermal: intel: Use generic trip points in 2 drivers
Date: Mon, 23 Jan 2023 19:36:52 +0100
Message-ID: <5916342.lOV4Wx5bFT@kreacher>
MIME-Version: 1.0
Content-Transfer-Encoding: 7Bit
Content-Type: text/plain; charset="UTF-8"
X-CLIENT-IP: 213.134.188.170
X-CLIENT-HOSTNAME: 213.134.188.170
X-VADE-SPAMSTATE: clean
X-VADE-SPAMCAUSE:
gggruggvucftvghtrhhoucdtuddrgedvhedruddukedguddtgecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffogffrnfdpggftiffpkfenuceurghilhhouhhtmecuudehtdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvvefufffkggfgtgesthfuredttddtjeenucfhrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqeenucggtffrrghtthgvrhhnpeegfffhudejlefhtdegffekteduhfethffhieettefhkeevgfdvgfefieekiefgheenucffohhmrghinhepkhgvrhhnvghlrdhorhhgnecukfhppedvudefrddufeegrddukeekrddujedtnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepvddufedrudefgedrudekkedrudejtddphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqedpnhgspghrtghpthhtohepiedprhgtphhtthhopehlihhnuhigqdhpmhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehsrhhinhhivhgrshdrphgrnhgurhhuvhgruggrsehlihhnuhigrdhinhhtvghlrdgtohhmpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthht
oheplhhinhhugidqrggtphhisehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtohepuggrnhhivghlrdhlvgiitggrnhhosehlihhnrghrohdrohhrghdprhgtphhtthhopehruhhirdiihhgrnhhgsehinhhtvghlrdgtohhm
X-DCC--Metrics: v370.home.net.pl 1024; Body=6 Fuz1=6 Fuz2=6
X-Spam-Status: No, score=-1.9 required=5.0 tests=BAYES_00,SPF_HELO_NONE,
SPF_PASS autolearn=ham autolearn_force=no version=3.4.6
X-Spam-Checker-Version: SpamAssassin 3.4.6 (2021-04-09) on
lindbergh.monkeyblade.net
Precedence: bulk
List-ID: <linux-kernel.vger.kernel.org>
X-Mailing-List: linux-kernel@vger.kernel.org
X-getmail-retrieved-from-mailbox: =?utf-8?q?INBOX?=
X-GMAIL-THRID: =?utf-8?q?1755840898279834765?=
X-GMAIL-MSGID: =?utf-8?q?1755840898279834765?=
|
| Series |
thermal: intel: Use generic trip points in 2 drivers
|
|
Message
Rafael J. Wysocki
Jan. 23, 2023, 6:36 p.m. UTC
Hi All, This is a new version of the series from Daniel posted as: https://lore.kernel.org/linux-pm/20230120231530.2368330-1-daniel.lezcano@linaro.org/ The first patch has been reworked (see https://lore.kernel.org/linux-pm/5911499.lOV4Wx5bFT@kreacher/) and the other two have been rebased on top of it. I have retained the R-by tags from Rui, because the changes in patches [2-3/3] are not essential, but I think that this new set needs to be tested again. Srinivas, can you test it please? Thanks!
Comments
On Monday, January 23, 2023 7:36:52 PM CET Rafael J. Wysocki wrote: > Hi All, > > This is a new version of the series from Daniel posted as: > > https://lore.kernel.org/linux-pm/20230120231530.2368330-1-daniel.lezcano@linaro.org/ > > The first patch has been reworked (see https://lore.kernel.org/linux-pm/5911499.lOV4Wx5bFT@kreacher/) > and the other two have been rebased on top of it. > > I have retained the R-by tags from Rui, because the changes in patches [2-3/3] are > not essential, but I think that this new set needs to be tested again. > > Srinivas, can you test it please? Something's wrong, sorry. I get some invalid trip temperatures with this set.
On Monday, January 23, 2023 7:45:30 PM CET Rafael J. Wysocki wrote: > On Monday, January 23, 2023 7:36:52 PM CET Rafael J. Wysocki wrote: > > Hi All, > > > > This is a new version of the series from Daniel posted as: > > > > https://lore.kernel.org/linux-pm/20230120231530.2368330-1-daniel.lezcano@linaro.org/ > > > > The first patch has been reworked (see https://lore.kernel.org/linux-pm/5911499.lOV4Wx5bFT@kreacher/) > > and the other two have been rebased on top of it. > > > > I have retained the R-by tags from Rui, because the changes in patches [2-3/3] are > > not essential, but I think that this new set needs to be tested again. > > > > Srinivas, can you test it please? > > Something's wrong, sorry. > > I get some invalid trip temperatures with this set. Sorry, scratch this, I got confused by THERMAL_TEMP_INVALID showing up in sysfs, but it did show up before too. Please test!
On Mon, 2023-01-23 at 19:52 +0100, Rafael J. Wysocki wrote: > On Monday, January 23, 2023 7:45:30 PM CET Rafael J. Wysocki wrote: > > On Monday, January 23, 2023 7:36:52 PM CET Rafael J. Wysocki wrote: > > > Hi All, > > > > > > This is a new version of the series from Daniel posted as: > > > > > > https://lore.kernel.org/linux-pm/20230120231530.2368330-1-daniel.lezcano@linaro.org/ > > > > > > The first patch has been reworked (see > > > https://lore.kernel.org/linux-pm/5911499.lOV4Wx5bFT@kreacher/) > > > and the other two have been rebased on top of it. > > > > > > I have retained the R-by tags from Rui, because the changes in > > > patches [2-3/3] are > > > not essential, but I think that this new set needs to be tested > > > again. > > > > > > Srinivas, can you test it please? > > > > Something's wrong, sorry. > > > > I get some invalid trip temperatures with this set. > > Sorry, scratch this, I got confused by THERMAL_TEMP_INVALID showing > up in > sysfs, but it did show up before too. > > Please test! > > > > It will be easy if you have some test branch to avoid dependecies on > other patches. Thanks, Srinivas > >
On Mon, Jan 23, 2023 at 8:26 PM srinivas pandruvada <srinivas.pandruvada@linux.intel.com> wrote: > > On Mon, 2023-01-23 at 19:52 +0100, Rafael J. Wysocki wrote: > > On Monday, January 23, 2023 7:45:30 PM CET Rafael J. Wysocki wrote: > > > On Monday, January 23, 2023 7:36:52 PM CET Rafael J. Wysocki wrote: > > > > Hi All, > > > > > > > > This is a new version of the series from Daniel posted as: > > > > > > > > https://lore.kernel.org/linux-pm/20230120231530.2368330-1-daniel.lezcano@linaro.org/ > > > > > > > > The first patch has been reworked (see > > > > https://lore.kernel.org/linux-pm/5911499.lOV4Wx5bFT@kreacher/) > > > > and the other two have been rebased on top of it. > > > > > > > > I have retained the R-by tags from Rui, because the changes in > > > > patches [2-3/3] are > > > > not essential, but I think that this new set needs to be tested > > > > again. > > > > > > > > Srinivas, can you test it please? > > > > > > Something's wrong, sorry. > > > > > > I get some invalid trip temperatures with this set. > > > > Sorry, scratch this, I got confused by THERMAL_TEMP_INVALID showing > > up in > > sysfs, but it did show up before too. > > > > Please test! > > > > > > > > > It will be easy if you have some test branch to avoid dependecies on > other patches. Please see the thermal-intel-test branch in linux-pm.git. It's this series on top of the core thermal stuff + ARM drivers.
On Mon, 2023-01-23 at 20:54 +0100, Rafael J. Wysocki wrote: > On Mon, Jan 23, 2023 at 8:26 PM srinivas pandruvada > <srinivas.pandruvada@linux.intel.com> wrote: > > > > On Mon, 2023-01-23 at 19:52 +0100, Rafael J. Wysocki wrote: > > > On Monday, January 23, 2023 7:45:30 PM CET Rafael J. Wysocki > > > wrote: > > > > On Monday, January 23, 2023 7:36:52 PM CET Rafael J. Wysocki > > > > wrote: > > > > > Hi All, > > > > > > > > > > This is a new version of the series from Daniel posted as: > > > > > > > > > > https://lore.kernel.org/linux-pm/20230120231530.2368330-1-daniel.lezcano@linaro.org/ > > > > > > > > > > The first patch has been reworked (see > > > > > https://lore.kernel.org/linux-pm/5911499.lOV4Wx5bFT@kreacher/ > > > > > ) > > > > > and the other two have been rebased on top of it. > > > > > > > > > > I have retained the R-by tags from Rui, because the changes > > > > > in > > > > > patches [2-3/3] are > > > > > not essential, but I think that this new set needs to be > > > > > tested > > > > > again. > > > > > > > > > > Srinivas, can you test it please? > > > > > > > > Something's wrong, sorry. > > > > > > > > I get some invalid trip temperatures with this set. > > > > > > Sorry, scratch this, I got confused by THERMAL_TEMP_INVALID > > > showing > > > up in > > > sysfs, but it did show up before too. > > > > > > Please test! > > > > > > > > > > > > > > > It will be easy if you have some test branch to avoid dependecies > > on > > other patches. > > Please see the thermal-intel-test branch in linux-pm.git. It's this > series on top of the core thermal stuff + ARM drivers. Tested on one system. Works fine. Thanks, Srinivas
On Mon, Jan 23, 2023 at 10:35 PM srinivas pandruvada <srinivas.pandruvada@linux.intel.com> wrote: > > On Mon, 2023-01-23 at 20:54 +0100, Rafael J. Wysocki wrote: > > On Mon, Jan 23, 2023 at 8:26 PM srinivas pandruvada > > <srinivas.pandruvada@linux.intel.com> wrote: > > > > > > On Mon, 2023-01-23 at 19:52 +0100, Rafael J. Wysocki wrote: > > > > On Monday, January 23, 2023 7:45:30 PM CET Rafael J. Wysocki > > > > wrote: > > > > > On Monday, January 23, 2023 7:36:52 PM CET Rafael J. Wysocki > > > > > wrote: > > > > > > Hi All, > > > > > > > > > > > > This is a new version of the series from Daniel posted as: > > > > > > > > > > > > https://lore.kernel.org/linux-pm/20230120231530.2368330-1-daniel.lezcano@linaro.org/ > > > > > > > > > > > > The first patch has been reworked (see > > > > > > https://lore.kernel.org/linux-pm/5911499.lOV4Wx5bFT@kreacher/ > > > > > > ) > > > > > > and the other two have been rebased on top of it. > > > > > > > > > > > > I have retained the R-by tags from Rui, because the changes > > > > > > in > > > > > > patches [2-3/3] are > > > > > > not essential, but I think that this new set needs to be > > > > > > tested > > > > > > again. > > > > > > > > > > > > Srinivas, can you test it please? > > > > > > > > > > Something's wrong, sorry. > > > > > > > > > > I get some invalid trip temperatures with this set. > > > > > > > > Sorry, scratch this, I got confused by THERMAL_TEMP_INVALID > > > > showing > > > > up in > > > > sysfs, but it did show up before too. > > > > > > > > Please test! > > > > > > > > > > > > > > > > > > > > > It will be easy if you have some test branch to avoid dependecies > > > on > > > other patches. > > > > Please see the thermal-intel-test branch in linux-pm.git. It's this > > series on top of the core thermal stuff + ARM drivers. > Tested on one system. Works fine. Thanks! I'll add a T-by from you to the series (which will be moved to the thermal-intel branch).