Message ID | 5640233.DvuYhMxLoT@kreacher |
---|---|
Headers |
Return-Path: <linux-kernel-owner@vger.kernel.org> Delivered-To: ouuuleilei@gmail.com Received: by 2002:a5d:6687:0:0:0:0:0 with SMTP id l7csp299743wru; Wed, 9 Nov 2022 04:18:05 -0800 (PST) X-Google-Smtp-Source: AMsMyM5eD8I1wBtdqdcNlbtUv+Lo0G9BMIdQOaf3f7kAieCQMMhWYkAE7gjmVzJGYvhqG2fgPckh X-Received: by 2002:a17:90a:fc94:b0:213:f73a:86a7 with SMTP id ci20-20020a17090afc9400b00213f73a86a7mr50096518pjb.144.1667996285148; Wed, 09 Nov 2022 04:18:05 -0800 (PST) ARC-Seal: i=1; a=rsa-sha256; t=1667996285; cv=none; d=google.com; s=arc-20160816; b=zdy56+i91fppEucWwIZLbZYrx1vyCvZEOLiE6m5y8AuQ4B6wSfErS2qiHcC34pgL2j QaTT3JA3nt37ZwcLTwKfuHoGLB65XlEyOMSqBjg5XS9N2ID/CoBTs5rWO9ix3Wc/5T// 2zCNEXkJxwIMb4hBEZHidFMMfI7brGZYewPlBJ1IlDQR5u60IGexzz+4yRU92b35J6eY QDzEVkP+tfskEoC2oKuBM0jMhZ6CLt/bnRJDzNsddD9QTSCM/1RcA6npQKDt0V6NEMiH fD+dy5blRGfRN5AYTDOtQdYa1nmoMc1bP972y5wc9YWqgvWwgDw9GWlbYjHQHC/EhwaX GXuw== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816; h=list-id:precedence:content-transfer-encoding:mime-version :message-id:date:subject:cc:to:from; bh=qs6EJHNg1hjgA8Ykmgf1CjkpKINcWFjBx6X+7nEOxtA=; b=OsicRSz92irWwJK+uoIN9BseszLcTYhf0sUeLEaC6sasd0NgKDNHfChMh80wckMjMI hWpcIW0EljhqdN3+fkuyRP0R+vvc9jWFRA69snjfeOPwtQi3juAhAvEa9XIMwvKmJrGr y6fV3VfHryFbcn3INY1kekzSkEv/lSpe/AfWOOLma0hdXS7OWy8xkXWEhEUjKQgoFirW K6gcvtsiyzo2qoObRb2KM4DSpyX690G09A+8B+XwMzLLgrlNaeJ9fzVZXQiOESu845m9 QrePlzDO1cHLp9zSB4dG1XfJraCDTYqqtAwgICIbZ6/xPSZQCAAetn1gW+9eAjheGuBz BiOg== ARC-Authentication-Results: i=1; mx.google.com; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::1:20 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Received: from out1.vger.email (out1.vger.email. [2620:137:e000::1:20]) by mx.google.com with ESMTP id r26-20020a6560da000000b0043946964302si18049881pgv.173.2022.11.09.04.17.51; Wed, 09 Nov 2022 04:18:05 -0800 (PST) Received-SPF: pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::1:20 as permitted sender) client-ip=2620:137:e000::1:20; Authentication-Results: mx.google.com; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::1:20 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S229938AbiKIMQN (ORCPT <rfc822;dexuan.linux@gmail.com> + 99 others); Wed, 9 Nov 2022 07:16:13 -0500 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:47638 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S229982AbiKIMQH (ORCPT <rfc822;linux-kernel@vger.kernel.org>); Wed, 9 Nov 2022 07:16:07 -0500 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id E7AF415822; Wed, 9 Nov 2022 04:15:56 -0800 (PST) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.0.0) id 50bdac1a47ab5b86; Wed, 9 Nov 2022 13:15:54 +0100 Received: from kreacher.localnet (unknown [213.134.163.195]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id 736CE66EBA7; Wed, 9 Nov 2022 13:15:53 +0100 (CET) Authentication-Results: v370.home.net.pl; dmarc=none (p=none dis=none) header.from=rjwysocki.net Authentication-Results: v370.home.net.pl; spf=fail smtp.mailfrom=rjwysocki.net From: "Rafael J. Wysocki" <rjw@rjwysocki.net> To: Alexandre Belloni <alexandre.belloni@bootlin.com>, linux-rtc@vger.kernel.org Cc: Linux ACPI <linux-acpi@vger.kernel.org>, LKML <linux-kernel@vger.kernel.org>, Linux PM <linux-pm@vger.kernel.org>, Zhang Rui <rui.zhang@intel.com>, Alessandro Zummo <a.zummo@towertech.it>, Andy Shevchenko <andriy.shevchenko@linux.intel.com>, Bjorn Helgaas <helgaas@kernel.org> Subject: [PATCH v2 0/5] rtc: rtc-cmos: Assorted ACPI-related cleanups and fixes Date: Wed, 09 Nov 2022 13:05:13 +0100 Message-ID: <5640233.DvuYhMxLoT@kreacher> MIME-Version: 1.0 Content-Transfer-Encoding: 7Bit Content-Type: text/plain; charset="UTF-8" X-CLIENT-IP: 213.134.163.195 X-CLIENT-HOSTNAME: 213.134.163.195 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedvgedrfedvgdefiecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffogffrnfdpggftiffpkfenuceurghilhhouhhtmecuudehtdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvvefufffkggfgtgesthfuredttddtjeenucfhrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqeenucggtffrrghtthgvrhhnpeegfffhudejlefhtdegffekteduhfethffhieettefhkeevgfdvgfefieekiefgheenucffohhmrghinhepkhgvrhhnvghlrdhorhhgnecukfhppedvudefrddufeegrdduieefrdduleehnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepvddufedrudefgedrudeifedrudelhedphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqedpnhgspghrtghpthhtohepledprhgtphhtthhopegrlhgvgigrnhgurhgvrdgsvghllhhonhhisegsohhothhlihhnrdgtohhmpdhrtghpthhtoheplhhinhhugidqrhhttgesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdgrtghpihesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdhk vghrnhgvlhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdhpmhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehruhhirdiihhgrnhhgsehinhhtvghlrdgtohhmpdhrtghpthhtoheprgdriihumhhmohesthhofigvrhhtvggthhdrihhtpdhrtghpthhtoheprghnughrihihrdhshhgvvhgthhgvnhhkoheslhhinhhugidrihhnthgvlhdrtghomhdprhgtphhtthhopehhvghlghgrrghssehkvghrnhgvlhdrohhrgh X-DCC--Metrics: v370.home.net.pl 1024; Body=9 Fuz1=9 Fuz2=9 X-Spam-Status: No, score=-1.9 required=5.0 tests=BAYES_00,SPF_HELO_NONE, SPF_PASS autolearn=ham autolearn_force=no version=3.4.6 X-Spam-Checker-Version: SpamAssassin 3.4.6 (2021-04-09) on lindbergh.monkeyblade.net Precedence: bulk List-ID: <linux-kernel.vger.kernel.org> X-Mailing-List: linux-kernel@vger.kernel.org X-getmail-retrieved-from-mailbox: =?utf-8?q?INBOX?= X-GMAIL-THRID: =?utf-8?q?1749020872818750271?= X-GMAIL-MSGID: =?utf-8?q?1749020872818750271?= |
Series |
rtc: rtc-cmos: Assorted ACPI-related cleanups and fixes
|
|
Message
Rafael J. Wysocki
Nov. 9, 2022, 12:05 p.m. UTC
Hi All, This is a v2 of the series previously posted as https://lore.kernel.org/linux-acpi/2276401.ElGaqSPkdT@kreacher/ The first three patches in the series have not changed since then (I have considered moving the last patch, which is a fix, to the front, but that turns out to be a bit cumbersome and not really worth the effort). This series of patches does some assorted ACPI-related cleanups to the CMOS RTC driver: - redundant static variable is dropped, - code duplication is reduced, - code is relocated so as to drop a few unnecessary forward declarations of functions, - functions are renamed to avoid confusion, and fixes up an issue in the driver removal path. Thanks!
Comments
On Wed, Nov 09, 2022 at 01:05:13PM +0100, Rafael J. Wysocki wrote: > Hi All, > > This is a v2 of the series previously posted as > > https://lore.kernel.org/linux-acpi/2276401.ElGaqSPkdT@kreacher/ > > The first three patches in the series have not changed since then (I have > considered moving the last patch, which is a fix, to the front, but that turns > out to be a bit cumbersome and not really worth the effort). > > This series of patches does some assorted ACPI-related cleanups to the CMOS RTC > driver: > - redundant static variable is dropped, > - code duplication is reduced, > - code is relocated so as to drop a few unnecessary forward declarations of > functions, > - functions are renamed to avoid confusion, > and fixes up an issue in the driver removal path. LGTM, FWIW, Reviewed-by: Andy Shevchenko <andriy.shevchenko@linux.intel.com>
On Wed, 2022-11-09 at 13:05 +0100, Rafael J. Wysocki wrote: > Hi All, > > This is a v2 of the series previously posted as > > https://lore.kernel.org/linux-acpi/2276401.ElGaqSPkdT@kreacher/ > > The first three patches in the series have not changed since then (I > have > considered moving the last patch, which is a fix, to the front, but > that turns > out to be a bit cumbersome and not really worth the effort). > > This series of patches does some assorted ACPI-related cleanups to > the CMOS RTC > driver: > - redundant static variable is dropped, > - code duplication is reduced, > - code is relocated so as to drop a few unnecessary forward > declarations of > functions, > - functions are renamed to avoid confusion, > and fixes up an issue in the driver removal path. > > > Reviewed-by: Zhang Rui <rui.zhang@intel.com> And I have tested the patch series on a platform with both use_acpi_alarm parameter set and cleared, the ACPI RTC fixed event works as expected, for both runtime and suspend wakeups. So Tested-by: Zhang Rui <rui.zhang@intel.com> thanks, rui
On Wed, 09 Nov 2022 13:05:13 +0100, Rafael J. Wysocki wrote: > This is a v2 of the series previously posted as > > https://lore.kernel.org/linux-acpi/2276401.ElGaqSPkdT@kreacher/ > > The first three patches in the series have not changed since then (I have > considered moving the last patch, which is a fix, to the front, but that turns > out to be a bit cumbersome and not really worth the effort). > > [...] Applied, thanks! [1/5] rtc: rtc-cmos: Call cmos_wake_setup() from cmos_do_probe() commit: 508ccdfb86b21da37ad091003a4d4567709d5dfb [2/5] rtc: rtc-cmos: Call rtc_wake_setup() from cmos_do_probe() commit: 375bbba09692fe4c5218eddee8e312dd733fa846 [3/5] rtc: rtc-cmos: Eliminate forward declarations of some functions commit: dca4d3b71c8a09a16951add656711fbd6f5bfbb0 [4/5] rtc: rtc-cmos: Rename ACPI-related functions commit: d13e9ad9f5146f066a5c5a1cc993d09e4fb21ead [5/5] rtc: rtc-cmos: Disable ACPI RTC event on removal commit: 83ebb7b3036d151ee39a4a752018665648fc3bd4 Best regards,