Message ID | 4556052.LvFx2qVVIh@kreacher |
---|---|
Headers |
Return-Path: <linux-kernel+bounces-1593-ouuuleilei=gmail.com@vger.kernel.org> Delivered-To: ouuuleilei@gmail.com Received: by 2002:a05:7300:3b04:b0:fb:cd0c:d3e with SMTP id c4csp9548673dys; Fri, 15 Dec 2023 12:11:35 -0800 (PST) X-Google-Smtp-Source: AGHT+IHb5p/pPmput356Yd484+wWrkdwCdgwhSpDtURFRYe3XZ/7rN4Plm6awYP3v+aTsSd0X6a7 X-Received: by 2002:a05:600c:2290:b0:40c:61a7:cf16 with SMTP id 16-20020a05600c229000b0040c61a7cf16mr1801935wmf.250.1702671095112; Fri, 15 Dec 2023 12:11:35 -0800 (PST) ARC-Seal: i=1; a=rsa-sha256; t=1702671095; cv=none; d=google.com; s=arc-20160816; b=FD/WKB3Bjnm7Oqj9q36I86qdh6diwd92DIgZhQkCv13H/dpdaKXdO+NEhFbG0/ddJd Dd+oH8KRSCp2ol6+gLYwc52gGPBLfZfOQJtQbIo4lU02plf1YU/IIXn6qkNkt/L0F/uR d8blVbnLd0XsMuDIPtX+h3M7HpEHl7ANY8/cUu2xqfEMEzR7aj1/1KAlj3aN5KbbXtyr Y9ahTRQxBuCCknKBUgFBv3YXnhr+RZjORGf8ZAAVOoFbACi98IB6XmT2HUqp5OilCPEb 8ukYaoNjMj5voyKV+3NTbVlwuRxzlRbsy8l+xOVYg13cAuF0yMPG//4r5omAFknDfkFC gM4A== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816; h=content-transfer-encoding:mime-version:list-unsubscribe :list-subscribe:list-id:precedence:message-id:date:subject:cc:to :from; bh=Dst7NW/7YIe/u7x8HG3jEuCNRE7o8xDqpA3+v+vv8Oc=; fh=PrtSuD01Zw+FPDhsRSNqLGqZbVeJkC2wpKMU0Il46xE=; b=Er4TtX1O9yNIDaTEr5j+tz8TQWUWfEj0klviouv+XLaLgyozyUwiIhORFBlh4kfn2N SJ2mJewj5kGm0SqSqNhaShBRn01wuj1NzRcfC+mwJBobRKJ+EsCfere5R1c7eDQXKHHv GiCZ0WQhkdOMNobtC2FZay9WO9xZ/H75j47ZPGqY9SXk5udP7dGZtqRWqWzD1EOhz4E2 xBeLP5yNvNl0F+Ky/M+lZ2Q1JYCBQ+EesDJAikXKnBfwM25++vjGtItLhaDOdqzDMzmp Qk4DcqVt+SiahJojktdBL5DXk55UnI/mHJSCHER67UXMrPwJqbgU+Qm7+vsTEG4q7o6s JFog== ARC-Authentication-Results: i=1; mx.google.com; spf=pass (google.com: domain of linux-kernel+bounces-1593-ouuuleilei=gmail.com@vger.kernel.org designates 2604:1380:4601:e00::3 as permitted sender) smtp.mailfrom="linux-kernel+bounces-1593-ouuuleilei=gmail.com@vger.kernel.org" Received: from am.mirrors.kernel.org (am.mirrors.kernel.org. [2604:1380:4601:e00::3]) by mx.google.com with ESMTPS id x20-20020a1709065ad400b00a1db8b87c58si7367712ejs.243.2023.12.15.12.11.34 for <ouuuleilei@gmail.com> (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Fri, 15 Dec 2023 12:11:35 -0800 (PST) Received-SPF: pass (google.com: domain of linux-kernel+bounces-1593-ouuuleilei=gmail.com@vger.kernel.org designates 2604:1380:4601:e00::3 as permitted sender) client-ip=2604:1380:4601:e00::3; Authentication-Results: mx.google.com; spf=pass (google.com: domain of linux-kernel+bounces-1593-ouuuleilei=gmail.com@vger.kernel.org designates 2604:1380:4601:e00::3 as permitted sender) smtp.mailfrom="linux-kernel+bounces-1593-ouuuleilei=gmail.com@vger.kernel.org" Received: from smtp.subspace.kernel.org (wormhole.subspace.kernel.org [52.25.139.140]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by am.mirrors.kernel.org (Postfix) with ESMTPS id E8F4F1F26E31 for <ouuuleilei@gmail.com>; Fri, 15 Dec 2023 20:04:05 +0000 (UTC) Received: from localhost.localdomain (localhost.localdomain [127.0.0.1]) by smtp.subspace.kernel.org (Postfix) with ESMTP id E457D4E61F; Fri, 15 Dec 2023 20:02:25 +0000 (UTC) X-Original-To: linux-kernel@vger.kernel.org Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id 3ACE345976; Fri, 15 Dec 2023 20:02:20 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; dmarc=none (p=none dis=none) header.from=rjwysocki.net Authentication-Results: smtp.subspace.kernel.org; spf=pass smtp.mailfrom=rjwysocki.net Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.4.0) id eb570ff9121704a3; Fri, 15 Dec 2023 21:02:19 +0100 Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by cloudserver094114.home.pl (Postfix) with ESMTPSA id 862B6668B59; Fri, 15 Dec 2023 21:02:18 +0100 (CET) From: "Rafael J. Wysocki" <rjw@rjwysocki.net> To: Linux PM <linux-pm@vger.kernel.org> Cc: Srinivas Pandruvada <srinivas.pandruvada@linux.intel.com>, Daniel Lezcano <daniel.lezcano@linaro.org>, Zhang Rui <rui.zhang@intel.com>, Linux ACPI <linux-acpi@vger.kernel.org>, LKML <linux-kernel@vger.kernel.org>, Lukasz Luba <lukasz.luba@arm.com> Subject: [PATCH v1 0/6] thermal: netlink: Redefine the API and drop unused code Date: Fri, 15 Dec 2023 20:51:30 +0100 Message-ID: <4556052.LvFx2qVVIh@kreacher> Precedence: bulk X-Mailing-List: linux-kernel@vger.kernel.org List-Id: <linux-kernel.vger.kernel.org> List-Subscribe: <mailto:linux-kernel+subscribe@vger.kernel.org> List-Unsubscribe: <mailto:linux-kernel+unsubscribe@vger.kernel.org> MIME-Version: 1.0 Content-Transfer-Encoding: 7Bit Content-Type: text/plain; charset="UTF-8" X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedvkedrvddtvddgudefudcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffogffrnfdpggftiffpkfenuceurghilhhouhhtmecuudehtdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvvefufffkggfgtgesthfuredttddtjeenucfhrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqeenucggtffrrghtthgvrhhnpeffffffkefgheehffelteeiveeffeevhfelteejvddvieejjeelvdeiheeuveeuffenucfkphepudelhedrudefiedrudelrdelgeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpeduleehrddufeeirdduledrleegpdhhvghlohepkhhrvggrtghhvghrrdhlohgtrghlnhgvthdpmhgrihhlfhhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqpdhnsggprhgtphhtthhopeejpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtohepshhrihhnihhvrghsrdhprghnughruhhvrggurgeslhhinhhugidrihhnthgvlhdrtghomhdprhgtphhtthhopegurghnihgvlhdrlhgviigtrghnoheslhhinhgrrhhordhorhhgpdhrtghpthhtoheprhhuihdriihhrghnghesihhnthgvlhdrtghomhdprhgtphht thhopehlihhnuhigqdgrtghpihesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdhkvghrnhgvlhesvhhgvghrrdhkvghrnhgvlhdrohhrgh X-DCC--Metrics: v370.home.net.pl 1024; Body=7 Fuz1=7 Fuz2=7 X-getmail-retrieved-from-mailbox: INBOX X-GMAIL-THRID: 1785380046308383456 X-GMAIL-MSGID: 1785380046308383456 |
Series |
thermal: netlink: Redefine the API and drop unused code
|
|
Message
Rafael J. Wysocki
Dec. 15, 2023, 7:51 p.m. UTC
Hi Everyone, This patch series redefines the thermal netlink API to be somewhat more convenient to use on the caller side and drops some unused code from the thermal netlink library. Please refer to the individual patch changelogs for details. Thanks!
Comments
On Fri, Dec 15, 2023 at 9:02 PM Rafael J. Wysocki <rjw@rjwysocki.net> wrote: > > Hi Everyone, > > This patch series redefines the thermal netlink API to be somewhat more > convenient to use on the caller side and drops some unused code from > the thermal netlink library. > > Please refer to the individual patch changelogs for details. No feedback, so this series doesn't appear to be controversial, and I would like to get it into 6.8. Tentatively queuing it up and please let me know if it is problematic. Thanks!
Hi Rafael, On 1/2/24 13:24, Rafael J. Wysocki wrote: > On Fri, Dec 15, 2023 at 9:02 PM Rafael J. Wysocki <rjw@rjwysocki.net> wrote: >> >> Hi Everyone, >> >> This patch series redefines the thermal netlink API to be somewhat more >> convenient to use on the caller side and drops some unused code from >> the thermal netlink library. >> >> Please refer to the individual patch changelogs for details. > > No feedback, so this series doesn't appear to be controversial, and I > would like to get it into 6.8. > > Tentatively queuing it up and please let me know if it is problematic. > > Thanks! > I agree, these are not controversial patches, so IMO queuing them is OK. I took a glance at them, but I can do the proper review today if you like. Regards, Lukasz
Hi Rafael, On 02/01/2024 14:24, Rafael J. Wysocki wrote: > On Fri, Dec 15, 2023 at 9:02 PM Rafael J. Wysocki <rjw@rjwysocki.net> wrote: >> >> Hi Everyone, >> >> This patch series redefines the thermal netlink API to be somewhat more >> convenient to use on the caller side and drops some unused code from >> the thermal netlink library. >> >> Please refer to the individual patch changelogs for details. > > No feedback, so this series doesn't appear to be controversial, and I > would like to get it into 6.8. > > Tentatively queuing it up and please let me know if it is problematic. I did not have time to review them properly and I'm OoO until next week. Is it possible to wait for the next time so I can review them ?
Hi Lukasz, On Wed, Jan 3, 2024 at 9:10 AM Lukasz Luba <lukasz.luba@arm.com> wrote: > > Hi Rafael, > > On 1/2/24 13:24, Rafael J. Wysocki wrote: > > On Fri, Dec 15, 2023 at 9:02 PM Rafael J. Wysocki <rjw@rjwysocki.net> wrote: > >> > >> Hi Everyone, > >> > >> This patch series redefines the thermal netlink API to be somewhat more > >> convenient to use on the caller side and drops some unused code from > >> the thermal netlink library. > >> > >> Please refer to the individual patch changelogs for details. > > > > No feedback, so this series doesn't appear to be controversial, and I > > would like to get it into 6.8. > > > > Tentatively queuing it up and please let me know if it is problematic. > > > > Thanks! > > > > I agree, these are not controversial patches, so IMO queuing them is OK. > I took a glance at them, but I can do the proper review today if you > like. Well, if you can allocate some time for that, it would be appreciated!
Hi Daniel, On Wed, Jan 3, 2024 at 10:54 AM Daniel Lezcano <daniel.lezcano@linaro.org> wrote: > > > Hi Rafael, > > On 02/01/2024 14:24, Rafael J. Wysocki wrote: > > On Fri, Dec 15, 2023 at 9:02 PM Rafael J. Wysocki <rjw@rjwysocki.net> wrote: > >> > >> Hi Everyone, > >> > >> This patch series redefines the thermal netlink API to be somewhat more > >> convenient to use on the caller side and drops some unused code from > >> the thermal netlink library. > >> > >> Please refer to the individual patch changelogs for details. > > > > No feedback, so this series doesn't appear to be controversial, and I > > would like to get it into 6.8. > > > > Tentatively queuing it up and please let me know if it is problematic. > > I did not have time to review them properly and I'm OoO until next week. > Is it possible to wait for the next time so I can review them ? I can defer them a few days of course, but if Lukasz can review them in the meantime, I think that should be sufficient?
On 1/3/24 10:24, Rafael J. Wysocki wrote: > Hi Lukasz, > > On Wed, Jan 3, 2024 at 9:10 AM Lukasz Luba <lukasz.luba@arm.com> wrote: >> >> Hi Rafael, >> >> On 1/2/24 13:24, Rafael J. Wysocki wrote: >>> On Fri, Dec 15, 2023 at 9:02 PM Rafael J. Wysocki <rjw@rjwysocki.net> wrote: >>>> >>>> Hi Everyone, >>>> >>>> This patch series redefines the thermal netlink API to be somewhat more >>>> convenient to use on the caller side and drops some unused code from >>>> the thermal netlink library. >>>> >>>> Please refer to the individual patch changelogs for details. >>> >>> No feedback, so this series doesn't appear to be controversial, and I >>> would like to get it into 6.8. >>> >>> Tentatively queuing it up and please let me know if it is problematic. >>> >>> Thanks! >>> >> >> I agree, these are not controversial patches, so IMO queuing them is OK. >> I took a glance at them, but I can do the proper review today if you >> like. > > Well, if you can allocate some time for that, it would be appreciated! Sure, no problem, I'll do that today.