Message ID | 3281896.aeNJFYEL58@kreacher |
---|---|
Headers |
Return-Path: <linux-kernel-owner@vger.kernel.org> Delivered-To: ouuuleilei@gmail.com Received: by 2002:a59:a5a7:0:b0:403:3b70:6f57 with SMTP id d7csp350157vqn; Wed, 29 Nov 2023 05:53:05 -0800 (PST) X-Google-Smtp-Source: AGHT+IH80Srqo6lSyWmUWZpkA3R9Snp7rSAChJulnjqGUndEcRkqkf+XI3f/JNkYv5zaQZ4BBeCj X-Received: by 2002:a05:6808:1818:b0:3af:5aa2:a3d with SMTP id bh24-20020a056808181800b003af5aa20a3dmr24571786oib.40.1701265985254; Wed, 29 Nov 2023 05:53:05 -0800 (PST) ARC-Seal: i=1; a=rsa-sha256; t=1701265985; cv=none; d=google.com; s=arc-20160816; b=w+SGQnsFD7rRyTtuOThyUvQOyjdC6eX+McBkIHB6mdH5HYVAMNbF321E/Blyc8C2nB rl++mVcifmUg4Z+Io2FFbMgNY7VqhpLc7lC9ZdGO8lwgEy+RwRxuUajtaNZJr+49OCCi MszScziMKIq8iORM2wec0jU6ZPtiDfrIAtggYAfjWloKlp6dH/cyRJwGhZo2a0ZhIITh iyhYQiGkamyO5oa8LgIRRb13s9SUb75lpgRdXm0rpvs2OtVZ+ijnJomj0UdP6ymQKP4G knPg0euwYI/NbImUhc3SIXAmVVMmPMmOO6lZmNIeKZhyMZUHh4Rdz0sLlvDOSUOySENW MicQ== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816; h=list-id:precedence:content-transfer-encoding:mime-version :message-id:date:subject:cc:to:from; bh=rWoItafasD9/TrlmQh5OBHx5LGYbbizzlvEwbpcCiJ4=; fh=Xy56yUsN7dnS9aJqFVOKrydaYiEvkn2fuPmAP6j6D88=; b=tftV/ENYqLPF0L4LeE2Q7Q0gWnLzwqakHrnE6vmXlyQPRyyIDkOvth79vcj9nv15GC KCS2mtsN0DkDg/cAO1wXV5H7ZbqxVDwaVNuGArNipqVZh/QiDE1KFDnr0W7HeusEMCV6 9aX16LtUxLo5Pq+QRmyE9bqXYIhmAMzDr09uV1D8IIn2BtaZQoxFyOq9nhsnnAvIwjMN Br0z7OwNPQ+FePx+JLrg6jcvlU6SpVqf7NIt4aXZ2oDVJrw/BNEiu5SuZQEIB2VU9+H+ h3w8BnKn7LI6aMeEr2tyddvh/W2F8eCP37N+l6RFCBI1xUTcE9QeldmHHg+CKxBgRU+m uUEQ== ARC-Authentication-Results: i=1; mx.google.com; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::3:7 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Received: from snail.vger.email (snail.vger.email. [2620:137:e000::3:7]) by mx.google.com with ESMTPS id h3-20020a63df43000000b005a9c40151b3si14567120pgj.804.2023.11.29.05.53.04 (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Wed, 29 Nov 2023 05:53:05 -0800 (PST) Received-SPF: pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::3:7 as permitted sender) client-ip=2620:137:e000::3:7; Authentication-Results: mx.google.com; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::3:7 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Received: from out1.vger.email (depot.vger.email [IPv6:2620:137:e000::3:0]) by snail.vger.email (Postfix) with ESMTP id 351E08030996; Wed, 29 Nov 2023 05:53:04 -0800 (PST) X-Virus-Status: Clean X-Virus-Scanned: clamav-milter 0.103.11 at snail.vger.email Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S234488AbjK2Nwv (ORCPT <rfc822;toshivichauhan@gmail.com> + 99 others); Wed, 29 Nov 2023 08:52:51 -0500 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:48318 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S234443AbjK2Nwr (ORCPT <rfc822;linux-kernel@vger.kernel.org>); Wed, 29 Nov 2023 08:52:47 -0500 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id 86F94DD; Wed, 29 Nov 2023 05:52:53 -0800 (PST) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.4.0) id 92cdc660a35cf56b; Wed, 29 Nov 2023 14:52:52 +0100 Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by cloudserver094114.home.pl (Postfix) with ESMTPSA id 86AD06684BD; Wed, 29 Nov 2023 14:52:51 +0100 (CET) From: "Rafael J. Wysocki" <rjw@rjwysocki.net> To: Linux ACPI <linux-acpi@vger.kernel.org> Cc: LKML <linux-kernel@vger.kernel.org>, Zhang Rui <rui.zhang@intel.com>, Srinivas Pandruvada <srinivas.pandruvada@linux.intel.com>, Michal Wilczynski <michal.wilczynski@intel.com>, Hans de Goede <hdegoede@redhat.com>, Andy Shevchenko <andriy.shevchenko@linux.intel.com>, Mika Westerberg <mika.westerberg@linux.intel.com>, Heikki Krogerus <heikki.krogerus@linux.intel.com>, Mario Limonciello <mario.limonciello@amd.com> Subject: [PATCH v1 0/4] ACPI: OSL: acpi_os_execute() improvements Date: Wed, 29 Nov 2023 14:45:54 +0100 Message-ID: <3281896.aeNJFYEL58@kreacher> MIME-Version: 1.0 Content-Transfer-Encoding: 7Bit Content-Type: text/plain; charset="UTF-8" X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedvkedrudeihedgheehucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffqoffgrffnpdggtffipffknecuuegrihhlohhuthemucduhedtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvfevufffkfgggfgtsehtufertddttdejnecuhfhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqnecuggftrfgrthhtvghrnhepgeffhfdujeelhfdtgeffkeetudfhtefhhfeiteethfekvefgvdfgfeeikeeigfehnecuffhomhgrihhnpehkvghrnhgvlhdrohhrghenucfkphepudelhedrudefiedrudelrdelgeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpeduleehrddufeeirdduledrleegpdhhvghlohepkhhrvggrtghhvghrrdhlohgtrghlnhgvthdpmhgrihhlfhhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqpdhnsggprhgtphhtthhopedutddprhgtphhtthhopehlihhnuhigqdgrtghpihesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdhkvghrnhgvlhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehruhhirdiihhgrnhhgsehinhhtvghlrdgtohhmpdhrtghpthhtohepshhrihhnihhvrghsrdhprghnughruhhv rggurgeslhhinhhugidrihhnthgvlhdrtghomhdprhgtphhtthhopehmihgthhgrlhdrfihilhgtiiihnhhskhhisehinhhtvghlrdgtohhmpdhrtghpthhtohephhguvghgohgvuggvsehrvgguhhgrthdrtghomh X-DCC--Metrics: v370.home.net.pl 1024; Body=10 Fuz1=10 Fuz2=10 X-Spam-Status: No, score=-1.9 required=5.0 tests=BAYES_00,SPF_HELO_NONE, SPF_PASS,T_SCC_BODY_TEXT_LINE autolearn=ham autolearn_force=no version=3.4.6 X-Spam-Checker-Version: SpamAssassin 3.4.6 (2021-04-09) on lindbergh.monkeyblade.net Precedence: bulk List-ID: <linux-kernel.vger.kernel.org> X-Mailing-List: linux-kernel@vger.kernel.org X-Greylist: Sender passed SPF test, not delayed by milter-greylist-4.6.4 (snail.vger.email [0.0.0.0]); Wed, 29 Nov 2023 05:53:04 -0800 (PST) X-getmail-retrieved-from-mailbox: INBOX X-GMAIL-THRID: 1783906681568240242 X-GMAIL-MSGID: 1783906681568240242 |
Series |
ACPI: OSL: acpi_os_execute() improvements
|
|
Message
Rafael J. Wysocki
Nov. 29, 2023, 1:45 p.m. UTC
Hi Everyone, This series improves acpi_os_execute() on top of https://patchwork.kernel.org/project/linux-acpi/patch/5745568.DvuYhMxLoT@kreacher/ but only the last patch really depends on it. The first two patches clean up the code somewhat and the third one modifies the function to allow Notify () handlers to run on all CPUs (not on CPU0 only). The last patch changes it to use GFP_KERNEL for memory allocations, as it does not run in interrupt context any more after the change linked above. Thanks!
Comments
Hi, On 11/29/23 14:45, Rafael J. Wysocki wrote: > Hi Everyone, > > This series improves acpi_os_execute() on top of > > https://patchwork.kernel.org/project/linux-acpi/patch/5745568.DvuYhMxLoT@kreacher/ > > but only the last patch really depends on it. > > The first two patches clean up the code somewhat and the third one modifies > the function to allow Notify () handlers to run on all CPUs (not on CPU0 only). > > The last patch changes it to use GFP_KERNEL for memory allocations, as it does > not run in interrupt context any more after the change linked above. I have added this series, as well as the preceding "ACPI: OSL: Use a threaded interrupt handler for SCI" patch to my personal tree now, so that it will get tested on various devices when I run my personal tree on them. I'll let you know if I hit any issues caused by this series. Regards, Hans
On Sat, Dec 2, 2023 at 3:31 PM Hans de Goede <hdegoede@redhat.com> wrote: > > Hi, > > On 11/29/23 14:45, Rafael J. Wysocki wrote: > > Hi Everyone, > > > > This series improves acpi_os_execute() on top of > > > > https://patchwork.kernel.org/project/linux-acpi/patch/5745568.DvuYhMxLoT@kreacher/ > > > > but only the last patch really depends on it. > > > > The first two patches clean up the code somewhat and the third one modifies > > the function to allow Notify () handlers to run on all CPUs (not on CPU0 only). > > > > The last patch changes it to use GFP_KERNEL for memory allocations, as it does > > not run in interrupt context any more after the change linked above. > > I have added this series, as well as the preceding > "ACPI: OSL: Use a threaded interrupt handler for SCI" > patch to my personal tree now, so that it will get tested on various > devices when I run my personal tree on them. > > I'll let you know if I hit any issues caused by this series. Thank you!
Hi Hans, On Sat, Dec 2, 2023 at 3:31 PM Hans de Goede <hdegoede@redhat.com> wrote: > > Hi, > > On 11/29/23 14:45, Rafael J. Wysocki wrote: > > Hi Everyone, > > > > This series improves acpi_os_execute() on top of > > > > https://patchwork.kernel.org/project/linux-acpi/patch/5745568.DvuYhMxLoT@kreacher/ > > > > but only the last patch really depends on it. > > > > The first two patches clean up the code somewhat and the third one modifies > > the function to allow Notify () handlers to run on all CPUs (not on CPU0 only). > > > > The last patch changes it to use GFP_KERNEL for memory allocations, as it does > > not run in interrupt context any more after the change linked above. > > I have added this series, as well as the preceding > "ACPI: OSL: Use a threaded interrupt handler for SCI" > patch to my personal tree now, so that it will get tested on various > devices when I run my personal tree on them. > > I'll let you know if I hit any issues caused by this series. As stated here https://lore.kernel.org/linux-acpi/CAJZ5v0jkHLGa2XxB4TMqzrBBdZYXY79+sh1Z0ZF6keYdLDyfkg@mail.gmail.com/ the last patch in this series is not really a good idea just yet, so please drop it. Thanks!
Hi, On 12/4/23 17:32, Rafael J. Wysocki wrote: > Hi Hans, > > On Sat, Dec 2, 2023 at 3:31 PM Hans de Goede <hdegoede@redhat.com> wrote: >> >> Hi, >> >> On 11/29/23 14:45, Rafael J. Wysocki wrote: >>> Hi Everyone, >>> >>> This series improves acpi_os_execute() on top of >>> >>> https://patchwork.kernel.org/project/linux-acpi/patch/5745568.DvuYhMxLoT@kreacher/ >>> >>> but only the last patch really depends on it. >>> >>> The first two patches clean up the code somewhat and the third one modifies >>> the function to allow Notify () handlers to run on all CPUs (not on CPU0 only). >>> >>> The last patch changes it to use GFP_KERNEL for memory allocations, as it does >>> not run in interrupt context any more after the change linked above. >> >> I have added this series, as well as the preceding >> "ACPI: OSL: Use a threaded interrupt handler for SCI" >> patch to my personal tree now, so that it will get tested on various >> devices when I run my personal tree on them. >> >> I'll let you know if I hit any issues caused by this series. > > As stated here > > https://lore.kernel.org/linux-acpi/CAJZ5v0jkHLGa2XxB4TMqzrBBdZYXY79+sh1Z0ZF6keYdLDyfkg@mail.gmail.com/ > > the last patch in this series is not really a good idea just yet, so > please drop it. Ack, done. Regards, Hans