Message ID | 1751684.VLH7GnMWUR@kreacher |
---|---|
Headers |
Return-Path: <linux-kernel-owner@vger.kernel.org> Delivered-To: ouuuleilei@gmail.com Received: by 2002:adf:eb09:0:0:0:0:0 with SMTP id s9csp2349568wrn; Mon, 30 Jan 2023 11:11:38 -0800 (PST) X-Google-Smtp-Source: AMrXdXtAnvmgCSd0hWxmr644A7t8YcFrZIrblqtIfNIPmQR2cKitgaG5EtuqcTHnsvyEQhvyBTnt X-Received: by 2002:a05:6402:2b92:b0:45a:7d2:9b35 with SMTP id fj18-20020a0564022b9200b0045a07d29b35mr53847655edb.0.1675105898148; Mon, 30 Jan 2023 11:11:38 -0800 (PST) ARC-Seal: i=1; a=rsa-sha256; t=1675105898; cv=none; d=google.com; s=arc-20160816; b=rEuLQLpnxUpEUWAmRe1SK0OaOWs3tJtE7pSMmO2IdAaTjZXa9iLzm2lRaEYE13dlW9 M2Tkp6ZjILmPkwwONDm9Wf7R1ho0x77+r1HDxDNBf1FyK50JgLxv9HtR3NLTGvdnq+68 RzPX6T83GiwyP+6cTYgZifB/0KIUfjKkqKiJMqC/nIAhL1JvskcSU+L7PLwdYq3uPU9t Fp5lSNjMY2kBDooLgkYAr5dAd9+Fq/J7YfZSVvD2LEvPBAUOUb3pXOs3Jx9s72myAzDE yr/SEW0rXFT7umN/0ItGzHwCbq2tVvtNXEB2tCRzDFDJ0BNIsR38KR8YQ9UixMJjQfo4 oYBQ== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816; h=list-id:precedence:content-transfer-encoding:mime-version :message-id:date:subject:cc:to:from; bh=RoAtN6g/yQJnn5wOphSLSOcwc2O2WBFxMkKC/PxRGdc=; b=GydH/hJEWQOTm7bz/EFBeHjci3ZhktQRl/r2Q+n7M6+bJ4ln15LcuFc8GWEt347D+0 lx8XbFDBQDXgd/x9ep08WE121di9rRSeTNCPJGk/FDaycJC2Ex6pfLpLpk/zIYPIKS3h grK5cH5UnXQDdoN4D3MhbSdGs5qNUk8mn82z0B3MtdCm/qSWS2hInidt24ZVPWXloQ5E nUYY2wd0F2Gts0antjr82M22H2NuCekhZcuc9qKT28LlF4pVB9STpc3XGMhUoKtQaq3+ InwCaXLRHjjploRsMp+qcN/TWp7nkaILRgnftB1Xhkdi/KcecgNsmiTnwJd2h5BqaLqa MFNQ== ARC-Authentication-Results: i=1; mx.google.com; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::1:20 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Received: from out1.vger.email (out1.vger.email. [2620:137:e000::1:20]) by mx.google.com with ESMTP id t34-20020a056402242200b004a0e1ab62ddsi14539199eda.625.2023.01.30.11.11.11; Mon, 30 Jan 2023 11:11:38 -0800 (PST) Received-SPF: pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::1:20 as permitted sender) client-ip=2620:137:e000::1:20; Authentication-Results: mx.google.com; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::1:20 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S238342AbjA3TIJ (ORCPT <rfc822;maxin.john@gmail.com> + 99 others); Mon, 30 Jan 2023 14:08:09 -0500 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:38750 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S238115AbjA3TH5 (ORCPT <rfc822;linux-kernel@vger.kernel.org>); Mon, 30 Jan 2023 14:07:57 -0500 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id C9E733B0CC; Mon, 30 Jan 2023 11:07:40 -0800 (PST) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.1.0) id 7011943c141ad891; Mon, 30 Jan 2023 20:07:38 +0100 Received: from kreacher.localnet (unknown [213.134.169.112]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id 2EC8E25277C6; Mon, 30 Jan 2023 20:07:38 +0100 (CET) From: "Rafael J. Wysocki" <rjw@rjwysocki.net> To: Linux PM <linux-pm@vger.kernel.org> Cc: Zhang Rui <rui.zhang@intel.com>, Srinivas Pandruvada <srinivas.pandruvada@linux.intel.com>, Linux ACPI <linux-acpi@vger.kernel.org>, LKML <linux-kernel@vger.kernel.org>, David Box <david.e.box@linux.intel.com> Subject: [PATCH v1 0/8] thermal: intel: intel_pch: Code simplification and cleanups Date: Mon, 30 Jan 2023 19:56:49 +0100 Message-ID: <1751684.VLH7GnMWUR@kreacher> MIME-Version: 1.0 Content-Transfer-Encoding: 7Bit Content-Type: text/plain; charset="UTF-8" X-CLIENT-IP: 213.134.169.112 X-CLIENT-HOSTNAME: 213.134.169.112 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedvhedrudefvddguddvfecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffogffrnfdpggftiffpkfenuceurghilhhouhhtmecuudehtdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvvefufffkggfgtgesthfuredttddtjeenucfhrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqeenucggtffrrghtthgvrhhnpeffffffkefgheehffelteeiveeffeevhfelteejvddvieejjeelvdeiheeuveeuffenucfkphepvddufedrudefgedrudeiledrudduvdenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpedvudefrddufeegrdduieelrdduuddvpdhhvghlohepkhhrvggrtghhvghrrdhlohgtrghlnhgvthdpmhgrihhlfhhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqpdhnsggprhgtphhtthhopeeipdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheprhhuihdriihhrghnghesihhnthgvlhdrtghomhdprhgtphhtthhopehsrhhinhhivhgrshdrphgrnhgurhhuvhgruggrsehlihhnuhigrdhinhhtvghlrdgtohhmpdhrtghpthhtoheplhhinhhugidqrggtphhisehvghgvrhdrkhgvrhhnvghlrdhorhhg pdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtohepuggrvhhiugdrvgdrsghogieslhhinhhugidrihhnthgvlhdrtghomh X-DCC--Metrics: v370.home.net.pl 1024; Body=6 Fuz1=6 Fuz2=6 X-Spam-Status: No, score=-1.9 required=5.0 tests=BAYES_00,SPF_HELO_NONE, SPF_PASS autolearn=ham autolearn_force=no version=3.4.6 X-Spam-Checker-Version: SpamAssassin 3.4.6 (2021-04-09) on lindbergh.monkeyblade.net Precedence: bulk List-ID: <linux-kernel.vger.kernel.org> X-Mailing-List: linux-kernel@vger.kernel.org X-getmail-retrieved-from-mailbox: =?utf-8?q?INBOX?= X-GMAIL-THRID: =?utf-8?q?1756475842583263719?= X-GMAIL-MSGID: =?utf-8?q?1756475842583263719?= |
Series |
thermal: intel: intel_pch: Code simplification and cleanups
|
|
Message
Rafael J. Wysocki
Jan. 30, 2023, 6:56 p.m. UTC
Hi All, This patch series removes some uneeded code and data structures from the intel_pch_thermal driver, rearranges it and does some assorted minor cleanups (no change in behavior should result from it). Please refer to the individual patch changelogs for details. Thanks!
Comments
On Mon, Jan 30, 2023 at 8:08 PM Rafael J. Wysocki <rjw@rjwysocki.net> wrote: > > Hi All, > > This patch series removes some uneeded code and data structures from the > intel_pch_thermal driver, rearranges it and does some assorted minor cleanups > (no change in behavior should result from it). > > Please refer to the individual patch changelogs for details. I forgot to mention that this series is applicable on top of https://patchwork.kernel.org/project/linux-pm/patch/5641279.DvuYhMxLoT@kreacher/ which in turn applies on top of the current thermal branch in linux-pm.git, that is also present in the linux-next branch in linux-pm.git. Thanks!
On Mon, 2023-01-30 at 19:56 +0100, Rafael J. Wysocki wrote: > Hi All, > > This patch series removes some uneeded code and data structures from > the > intel_pch_thermal driver, rearranges it and does some assorted minor > cleanups > (no change in behavior should result from it). > > Please refer to the individual patch changelogs for details. > > Thanks! > Tested on one KBL-R platform, everything works fine. Tested-by: Zhang Rui <rui.zhang@intel.com> Reviewed-by: Zhang Rui <rui.zhang@intel.com> thanks, rui
On Wed, 2023-02-01 at 17:06 +0800, Zhang Rui wrote: > On Mon, 2023-01-30 at 19:56 +0100, Rafael J. Wysocki wrote: > > Hi All, > > > > This patch series removes some uneeded code and data structures > > from > > the > > intel_pch_thermal driver, rearranges it and does some assorted > > minor > > cleanups > > (no change in behavior should result from it). > > > > Please refer to the individual patch changelogs for details. > > > > Thanks! > > > Tested on one KBL-R platform, everything works fine. > > Tested-by: Zhang Rui <rui.zhang@intel.com> > Reviewed-by: Zhang Rui <rui.zhang@intel.com> Forgot to mention, I tested patch 1~7 in this series, plus the appended patch in patch 7/8 thread. > > thanks, > rui
On Mon, 2023-01-30 at 20:13 +0100, Rafael J. Wysocki wrote: > On Mon, Jan 30, 2023 at 8:08 PM Rafael J. Wysocki <rjw@rjwysocki.net> > wrote: > > Hi All, > > > > This patch series removes some uneeded code and data structures > > from the > > intel_pch_thermal driver, rearranges it and does some assorted > > minor cleanups > > (no change in behavior should result from it). > > > > Please refer to the individual patch changelogs for details. > > I forgot to mention that this series is applicable on top of > > https://patchwork.kernel.org/project/linux-pm/patch/5641279.DvuYhMxLoT@kreacher/ > > which in turn applies on top of the current thermal branch in linux- > pm.git, > that is also present in the linux-next branch in linux-pm.git. > I also tested your linux-next branch but without the "thermal" merge. -/sys/class/thermal/thermal_zone7/trip_point_4_temp:-32768000 +/sys/class/thermal/thermal_zone7/trip_point_4_hyst:0 +/sys/class/thermal/thermal_zone7/trip_point_4_temp:-2147483648 The new "hyst" attribute is not a problem as it is mandatory for generic trips. The temp value changes is introduced by commit 3d2f20ad46f8 ("wifi: iwlwifi: Use generic thermal_zone_get_trip() function") - for (i = 0 ; i < IWL_MAX_DTS_TRIPS; i++) - mvm->tz_device.temp_trips[i] = S16_MIN; + for (i = 0 ; i < IWL_MAX_DTS_TRIPS; i++) { + mvm->tz_device.trips[i].temperature = INT_MIN; + mvm->tz_device.trips[i].type = THERMAL_TRIP_PASSIVE; + } It is kind of strange to use different values, but both represents a bogus temperature. What about using THERMAL_TEMP_INVALID for future consistency? thanks, rui