Message ID | 13318886.uLZWGnKmhe@kreacher |
---|---|
Headers |
Return-Path: <linux-kernel-owner@vger.kernel.org> Delivered-To: ouuuleilei@gmail.com Received: by 2002:a59:c923:0:b0:3e4:2afc:c1 with SMTP id j3csp1940932vqt; Tue, 18 Jul 2023 11:47:14 -0700 (PDT) X-Google-Smtp-Source: APBJJlGObhZGxlciFUyNLS7SbTIcVkuSj58EQPmbmr9+i0kqHtgP06CzLf0KxFrVlQvwPkavd6Vx X-Received: by 2002:aa7:cd47:0:b0:51d:d568:fa49 with SMTP id v7-20020aa7cd47000000b0051dd568fa49mr708011edw.12.1689706034359; Tue, 18 Jul 2023 11:47:14 -0700 (PDT) ARC-Seal: i=1; a=rsa-sha256; t=1689706034; cv=none; d=google.com; s=arc-20160816; b=SgSK0ZiWVMulKR6cyOZ9Out4fRw52FjkvekW2C5zH+mFe8uFoViFALSLNsaD3L4yqd GMkBEJItDby/RaZ3woegPDrv2FmMhG/awXF0pRv2dlFRs5EUUMpuOjQDBzPoMwbaaqGi QRzM1gt98ZqdHbUiOsF8+uUiNPBSgJJA9m5aogZue+0P6EaKlC0uWKgh9o/0V+qQJvUI ECL1GWk9zHE9BT9gBGNLnzyXxhdpt33WrIF96WuR5f8Nc/W5A44t4jMpSB6sQf6UfgNp 9X7D3RVdlbVzxTkr5qb773VAExzzZlUTtXPaEvGsU6vgzlew84n2s6qHaK03Jig4k43H kjFw== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816; h=list-id:precedence:content-transfer-encoding:mime-version :message-id:date:subject:cc:to:from; bh=fJLfU3xy2ashav9LR3x9X6K/YomuVTI/sMFV1AF+1dE=; fh=WAm0nkxw3rD71A4QzwJS1JiPPKRsyn91IiWMPsOrzoY=; b=lFddPgVq5BWztNk75r2yK/j8FZWkRASYdzosMORsQVJphU1eBDCchzXwiByAf/Y2GB ZtrjzcuwLG+fbLf+fsc30SqkCgUF2/hHG/wfbLna+MfaFUyWYsqqPE/SHRZN1g3n9XmQ 7KxWnxNCKFGF3y09j6ylDbVZmILr9stqQOJsOUkt3QgT6zzh7G/s7Fnn8/Y71jx/cJKr s6PELHt4mldYDH9RULHJEIydsx/43Y3RSS2gAb+Oh12hmGzliVekLHosD+t0etpmwyoH IXfDnUbwQ+gRnzAFpRJXF8ueE5Y7x7sSqz+GP3JSDBeo1ovCbe0kCbzd8yHOGS/bKfKE 1v3w== ARC-Authentication-Results: i=1; mx.google.com; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::1:20 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Received: from out1.vger.email (out1.vger.email. [2620:137:e000::1:20]) by mx.google.com with ESMTP id l1-20020a056402124100b0051e0fbedc14si1521726edw.411.2023.07.18.11.46.47; Tue, 18 Jul 2023 11:47:14 -0700 (PDT) Received-SPF: pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::1:20 as permitted sender) client-ip=2620:137:e000::1:20; Authentication-Results: mx.google.com; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::1:20 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S229997AbjGRSWA (ORCPT <rfc822;assdfgzxcv4@gmail.com> + 99 others); Tue, 18 Jul 2023 14:22:00 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:55356 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S229750AbjGRSVs (ORCPT <rfc822;linux-kernel@vger.kernel.org>); Tue, 18 Jul 2023 14:21:48 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id 508B9E8; Tue, 18 Jul 2023 11:21:30 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id 6ac080c78dc13803; Tue, 18 Jul 2023 20:21:28 +0200 Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id 1E5DA6614F7; Tue, 18 Jul 2023 20:21:28 +0200 (CEST) From: "Rafael J. Wysocki" <rjw@rjwysocki.net> To: Linux ACPI <linux-acpi@vger.kernel.org> Cc: LKML <linux-kernel@vger.kernel.org>, Linux PM <linux-pm@vger.kernel.org>, Michal Wilczynski <michal.wilczynski@intel.com>, Zhang Rui <rui.zhang@intel.com>, Srinivas Pandruvada <srinivas.pandruvada@linux.intel.com>, Daniel Lezcano <daniel.lezcano@linaro.org> Subject: [PATCH v1 0/7] ACPI: thermal: Use trip point table to register thermal zones Date: Tue, 18 Jul 2023 20:01:20 +0200 Message-ID: <13318886.uLZWGnKmhe@kreacher> MIME-Version: 1.0 Content-Transfer-Encoding: 7Bit Content-Type: text/plain; charset="UTF-8" X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrgeeggdduudelucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffqoffgrffnpdggtffipffknecuuegrihhlohhuthemucduhedtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvfevufffkfgggfgtsehtufertddttdejnecuhfhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqnecuggftrfgrthhtvghrnhepffffffekgfehheffleetieevfeefvefhleetjedvvdeijeejledvieehueevueffnecukfhppeduleehrddufeeirdduledrleegnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepudelhedrudefiedrudelrdelgedphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqedpnhgspghrtghpthhtohepjedprhgtphhtthhopehlihhnuhigqdgrtghpihesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdhkvghrnhgvlhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdhpmhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehmihgthhgrlhdrfihilhgtiiihnhhskhhisehinhhtvghlrdgtohhmpdhrtghp thhtoheprhhuihdriihhrghnghesihhnthgvlhdrtghomhdprhgtphhtthhopehsrhhinhhivhgrshdrphgrnhgurhhuvhgruggrsehlihhnuhigrdhinhhtvghlrdgtohhm X-DCC--Metrics: v370.home.net.pl 1024; Body=7 Fuz1=7 Fuz2=7 X-Spam-Status: No, score=-1.9 required=5.0 tests=BAYES_00, RCVD_IN_DNSWL_BLOCKED,SPF_HELO_NONE,SPF_PASS,T_SCC_BODY_TEXT_LINE autolearn=ham autolearn_force=no version=3.4.6 X-Spam-Checker-Version: SpamAssassin 3.4.6 (2021-04-09) on lindbergh.monkeyblade.net Precedence: bulk List-ID: <linux-kernel.vger.kernel.org> X-Mailing-List: linux-kernel@vger.kernel.org X-getmail-retrieved-from-mailbox: INBOX X-GMAIL-THRID: 1771784738121547230 X-GMAIL-MSGID: 1771785194985194655 |
Series |
ACPI: thermal: Use trip point table to register thermal zones
|
|
Message
Rafael J. Wysocki
July 18, 2023, 6:01 p.m. UTC
Hi Everyone, This patch series makes the ACPI thermal driver register thermal zones with the help of thermal_zone_device_register_with_trips(), so it doesn't need to use the thermal zone callbacks related to trip points any more (and they are dropped in the last patch). The approach presented here is quite radically different from the previous attempts, as it doesn't really rearrange the driver's internal data structures, but adds the trip table support on top of them. For this purpose, it uses an additional field in struct thermal_trip introduced in the first patch. I have run it on my test-bed systems, but this is not too representative, because they each have only one ACPI thermal zone with only one (critical) trip point in it. Thanks, Rafael
Comments
Hi Rafael, On 18/07/2023 20:01, Rafael J. Wysocki wrote: > Hi Everyone, > > This patch series makes the ACPI thermal driver register thermal zones > with the help of thermal_zone_device_register_with_trips(), so it > doesn't need to use the thermal zone callbacks related to trip points > any more (and they are dropped in the last patch). Yay! > The approach presented here is quite radically different from the > previous attempts, as it doesn't really rearrange the driver's > internal data structures, but adds the trip table support on top of > them. For this purpose, it uses an additional field in struct thermal_trip > introduced in the first patch. > > I have run it on my test-bed systems, but this is not too representative, > because they each have only one ACPI thermal zone with only one (critical) > trip point in it. Rui created some ACPI fake tables I was able to run them in a KVM machine with fake thermal zones. I can share the setup if you are interested in
On Wed, Jul 19, 2023 at 12:46 AM Daniel Lezcano <daniel.lezcano@linaro.org> wrote: > > > Hi Rafael, > > On 18/07/2023 20:01, Rafael J. Wysocki wrote: > > Hi Everyone, > > > > This patch series makes the ACPI thermal driver register thermal zones > > with the help of thermal_zone_device_register_with_trips(), so it > > doesn't need to use the thermal zone callbacks related to trip points > > any more (and they are dropped in the last patch). > > Yay! > > > The approach presented here is quite radically different from the > > previous attempts, as it doesn't really rearrange the driver's > > internal data structures, but adds the trip table support on top of > > them. For this purpose, it uses an additional field in struct thermal_trip > > introduced in the first patch. > > > > I have run it on my test-bed systems, but this is not too representative, > > because they each have only one ACPI thermal zone with only one (critical) > > trip point in it. > > Rui created some ACPI fake tables I was able to run them in a KVM > machine with fake thermal zones. > > I can share the setup if you are interested in Yes, please!