Message ID | 22182690.EfDdHjke4D@kreacher |
---|---|
State | New |
Headers |
Return-Path: <linux-kernel+bounces-62211-ouuuleilei=gmail.com@vger.kernel.org> Delivered-To: ouuuleilei@gmail.com Received: by 2002:a05:7300:bc8a:b0:106:860b:bbdd with SMTP id dn10csp102420dyb; Mon, 12 Feb 2024 10:44:51 -0800 (PST) X-Forwarded-Encrypted: i=3; AJvYcCWcAkuutXYtBpe6azOfgAV2CU47KTmsPT/FnrKwCkRaGY3HiIDZZNJYqzN8U3Ux+t+oYS2V/wBRTDYH0D6pul28eZh6Pg== X-Google-Smtp-Source: AGHT+IGA36QgaLGRV6YN0wFEzjorE993A5oM0dcKb6ZZv9QYwh9souOZBSP6AcovrXIO1k3ViLO1 X-Received: by 2002:a2e:7d11:0:b0:2d0:e4e8:c999 with SMTP id y17-20020a2e7d11000000b002d0e4e8c999mr4476607ljc.3.1707763490803; Mon, 12 Feb 2024 10:44:50 -0800 (PST) ARC-Seal: i=2; a=rsa-sha256; t=1707763490; cv=pass; d=google.com; s=arc-20160816; b=c6ZjgLSJfdZR6UnkyRutEf3brL6/8Uk8UfFZlSxwfP7TXgK9yQVnGaJNa1w1Zoz8Jy E/HucCrjNbODlSOqwk/UMm7tabGXoOxixp0FU+qVUEkXAU+CGC1naaNtuJnTzA+HHi7E dM1DFE3Kplb0X9883Gbi+diZdK46hWtzWsYC1Pqg5ifvwMNhg6oo06kqx30SLNqUdI00 Qha41GXWk8nYdsjcGImyva3Sn/OO1t21iqGXyS5JU79GAXg4lPdTlnQRjoqmJz3pFW4J Fpj8HX9+QIJqVcMQIlUGmTWOBZJpheYjLfkdBlUKWJ5kQJiFOa35YzwTnuaDorsVlOjD ZJZA== ARC-Message-Signature: i=2; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816; h=content-transfer-encoding:mime-version:list-unsubscribe :list-subscribe:list-id:precedence:references:in-reply-to:message-id :date:subject:cc:to:from; bh=vhY0L/q+gYzWXX9S6sUejlhI+rPSgEyGab12EG2fBqA=; fh=YCvah8plCBl1aXQyX3LpO3L2infw873NM+962Ii7B9o=; b=bjMo/CJULQWDS3vmek9tm58zTYEeGmwGq344HSrtDYYTSoOFcfskH1k3atroZaZ7lp o4ljIosSdztH3yFjJ9OISkmwTMMDcNbR58l9AUiZr1cI6C6O0WRgpxg19nh9wblXa7LI MMZZPRz9sWrlTX3Jh5r77mCeDv54JFKcWH5mCO2PNIdpDEg2VFeCjAdFuWfumYRA5CkE zZgUb5Y+r2HNG6mnGA8+SMAu5XoZSUVfXKtDa/CKAuEM2pmEXnfY125tN/oVtVu4eB12 te9CBHR/egwpDrMH0Ybugb+A2DirzexMIXAd0rcIJU//1fe1zETooibkNzps1ocd0fUG aLvg==; dara=google.com ARC-Authentication-Results: i=2; mx.google.com; arc=pass (i=1 spf=pass spfdomain=rjwysocki.net); spf=pass (google.com: domain of linux-kernel+bounces-62211-ouuuleilei=gmail.com@vger.kernel.org designates 2604:1380:4601:e00::3 as permitted sender) smtp.mailfrom="linux-kernel+bounces-62211-ouuuleilei=gmail.com@vger.kernel.org" X-Forwarded-Encrypted: i=2; AJvYcCXPBU2zIAD6vmag149CVpFV+Ebhurk9L+mhk1usRIg0K3iazNtwsL97DEJUsxNWPZ+n16Waz5jMDRhxiP3TVQUBhzt2TQ== Received: from am.mirrors.kernel.org (am.mirrors.kernel.org. [2604:1380:4601:e00::3]) by mx.google.com with ESMTPS id e7-20020a056402190700b00561d7e8cf17si448457edz.152.2024.02.12.10.44.50 for <ouuuleilei@gmail.com> (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Mon, 12 Feb 2024 10:44:50 -0800 (PST) Received-SPF: pass (google.com: domain of linux-kernel+bounces-62211-ouuuleilei=gmail.com@vger.kernel.org designates 2604:1380:4601:e00::3 as permitted sender) client-ip=2604:1380:4601:e00::3; Authentication-Results: mx.google.com; arc=pass (i=1 spf=pass spfdomain=rjwysocki.net); spf=pass (google.com: domain of linux-kernel+bounces-62211-ouuuleilei=gmail.com@vger.kernel.org designates 2604:1380:4601:e00::3 as permitted sender) smtp.mailfrom="linux-kernel+bounces-62211-ouuuleilei=gmail.com@vger.kernel.org" Received: from smtp.subspace.kernel.org (wormhole.subspace.kernel.org [52.25.139.140]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by am.mirrors.kernel.org (Postfix) with ESMTPS id 653461F23C74 for <ouuuleilei@gmail.com>; Mon, 12 Feb 2024 18:44:50 +0000 (UTC) Received: from localhost.localdomain (localhost.localdomain [127.0.0.1]) by smtp.subspace.kernel.org (Postfix) with ESMTP id 2309B4CE06; Mon, 12 Feb 2024 18:42:37 +0000 (UTC) Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id AC21B3FE44; Mon, 12 Feb 2024 18:42:32 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; arc=none smtp.client-ip=79.96.170.134 ARC-Seal: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1707763355; cv=none; b=kZj2N1GMp61RygJFLN6KheHfv5jwLd5Gu8LoouABzpFn9CsAg5pZ8cPaWL42zkIGzj9PxT1YFaXGfMw7Yg8Xg7OK0fKWWy4Jmu9zHy41UDZ/oJ79cTSqVR6ufya9FIAbNgeRQRdvsZzu3HX0wpNBU8q46XrdIfV0+HR0MIFO0XI= ARC-Message-Signature: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1707763355; c=relaxed/simple; bh=0fjHyFCgQiCJ7Xf9wqWXnNvGeNJWsCVj3Z7wFx692qc=; h=From:To:Cc:Subject:Date:Message-ID:In-Reply-To:References: MIME-Version:Content-Type; b=ogUnMkS7nCblb10QkqU3rySOZBGpWtZ4Rm9oiJlxmMwaIEvbTmac0py1hw4x0MiPz00D8dB/LAu+CGhV+OIdGu4oGLEFmL7qfD8M27e9eI5Q0XcTIEMdGq2xuIOGBmLKcEAnzO3tVhnLrPIT93owoBoKFozxmzPQxl3JTcKiFSw= ARC-Authentication-Results: i=1; smtp.subspace.kernel.org; dmarc=none (p=none dis=none) header.from=rjwysocki.net; spf=pass smtp.mailfrom=rjwysocki.net; arc=none smtp.client-ip=79.96.170.134 Authentication-Results: smtp.subspace.kernel.org; dmarc=none (p=none dis=none) header.from=rjwysocki.net Authentication-Results: smtp.subspace.kernel.org; spf=pass smtp.mailfrom=rjwysocki.net Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.4.0) id e1f8ca868e59d311; Mon, 12 Feb 2024 19:42:30 +0100 Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by cloudserver094114.home.pl (Postfix) with ESMTPSA id 2107C669CF2; Mon, 12 Feb 2024 19:42:30 +0100 (CET) From: "Rafael J. Wysocki" <rjw@rjwysocki.net> To: Linux PM <linux-pm@vger.kernel.org> Cc: Lukasz Luba <lukasz.luba@arm.com>, LKML <linux-kernel@vger.kernel.org>, Daniel Lezcano <daniel.lezcano@linaro.org>, Stanislaw Gruszka <stanislaw.gruszka@linux.intel.com>, Srinivas Pandruvada <srinivas.pandruvada@linux.intel.com>, Zhang Rui <rui.zhang@intel.com>, netdev@vger.kernel.org, Ido Schimmel <idosch@nvidia.com>, Petr Machata <petrm@nvidia.com>, Miri Korenblit <miriam.rachel.korenblit@intel.com>, linux-wireless@vger.kernel.org, Shawn Guo <shawnguo@kernel.org>, Sascha Hauer <s.hauer@pengutronix.de>, Pengutronix Kernel Team <kernel@pengutronix.de>, Manaf Meethalavalappu Pallikunhi <quic_manafm@quicinc.com> Subject: [PATCH v2 6/9] wifi: iwlwifi: mvm: Set THERMAL_TRIP_FLAG_RW_TEMP directly Date: Mon, 12 Feb 2024 19:38:07 +0100 Message-ID: <22182690.EfDdHjke4D@kreacher> In-Reply-To: <6017196.lOV4Wx5bFT@kreacher> References: <6017196.lOV4Wx5bFT@kreacher> Precedence: bulk X-Mailing-List: linux-kernel@vger.kernel.org List-Id: <linux-kernel.vger.kernel.org> List-Subscribe: <mailto:linux-kernel+subscribe@vger.kernel.org> List-Unsubscribe: <mailto:linux-kernel+unsubscribe@vger.kernel.org> MIME-Version: 1.0 Content-Transfer-Encoding: 7Bit Content-Type: text/plain; charset="UTF-8" X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedvledrudefgdduudegucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffqoffgrffnpdggtffipffknecuuegrihhlohhuthemucduhedtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvfevufffkfgjfhgggfgtsehtufertddttdejnecuhfhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqnecuggftrfgrthhtvghrnhepvdffueeitdfgvddtudegueejtdffteetgeefkeffvdeftddttdeuhfegfedvjefhnecukfhppeduleehrddufeeirdduledrleegnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepudelhedrudefiedrudelrdelgedphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqedpnhgspghrtghpthhtohepudeipdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhukhgrshiirdhluhgsrgesrghrmhdrtghomhdprhgtphhtthhopehlihhnuhigqdhkvghrnhgvlhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopegurghnihgvlhdrlhgviigtrghnoheslhhinhgrrhhordhorhhgpdhrtghpthhtohepshht rghnihhslhgrfidrghhruhhsiihkrgeslhhinhhugidrihhnthgvlhdrtghomhdprhgtphhtthhopehsrhhinhhivhgrshdrphgrnhgurhhuvhgruggrsehlihhnuhigrdhinhhtvghlrdgtohhm X-DCC--Metrics: v370.home.net.pl 1024; Body=16 Fuz1=16 Fuz2=16 X-getmail-retrieved-from-mailbox: INBOX X-GMAIL-THRID: 1790719809841514919 X-GMAIL-MSGID: 1790719809841514919 |
Series |
thermal: Writable trip points handling rework
|
|
Commit Message
Rafael J. Wysocki
Feb. 12, 2024, 6:38 p.m. UTC
From: Rafael J. Wysocki <rafael.j.wysocki@intel.com> It is now possible to flag trip points with THERMAL_TRIP_FLAG_RW_TEMP to allow their temperature to be set from user space via sysfs instead of using a nonzero writable trips mask during thermal zone registration, so make the iwlwifi code do that. No intentional functional impact. Note that this change is requisite for dropping the mask argument from thermal_zone_device_register_with_trips() going forward. Signed-off-by: Rafael J. Wysocki <rafael.j.wysocki@intel.com> --- v1 -> v2: * Rename trip flag (Stanislaw). * Fix coding mistake in iwl_mvm_thermal_zone_register(). * Add "wifi:" prefix to the subject (Kalle). --- drivers/net/wireless/intel/iwlwifi/mvm/tt.c | 6 ++---- 1 file changed, 2 insertions(+), 4 deletions(-)
Comments
On Mon, Feb 12, 2024 at 7:42 PM Rafael J. Wysocki <rjw@rjwysocki.net> wrote: > > From: Rafael J. Wysocki <rafael.j.wysocki@intel.com> > > It is now possible to flag trip points with THERMAL_TRIP_FLAG_RW_TEMP > to allow their temperature to be set from user space via sysfs instead > of using a nonzero writable trips mask during thermal zone registration, > so make the iwlwifi code do that. > > No intentional functional impact. > > Note that this change is requisite for dropping the mask argument from > thermal_zone_device_register_with_trips() going forward. > > Signed-off-by: Rafael J. Wysocki <rafael.j.wysocki@intel.com> > --- > > v1 -> v2: > * Rename trip flag (Stanislaw). > * Fix coding mistake in iwl_mvm_thermal_zone_register(). > * Add "wifi:" prefix to the subject (Kalle). I think that all of the feedback on the v1 of this patch has been addressed, so are there any more concerns regarding it? If not, it would be nice to get an ACK for it, so it can be routed through the PM tree. > --- > drivers/net/wireless/intel/iwlwifi/mvm/tt.c | 6 ++---- > 1 file changed, 2 insertions(+), 4 deletions(-) > > Index: linux-pm/drivers/net/wireless/intel/iwlwifi/mvm/tt.c > =================================================================== > --- linux-pm.orig/drivers/net/wireless/intel/iwlwifi/mvm/tt.c > +++ linux-pm/drivers/net/wireless/intel/iwlwifi/mvm/tt.c > @@ -667,9 +667,6 @@ static struct thermal_zone_device_ops t > .set_trip_temp = iwl_mvm_tzone_set_trip_temp, > }; > > -/* make all trips writable */ > -#define IWL_WRITABLE_TRIPS_MSK (BIT(IWL_MAX_DTS_TRIPS) - 1) > - > static void iwl_mvm_thermal_zone_register(struct iwl_mvm *mvm) > { > int i, ret; > @@ -692,11 +689,12 @@ static void iwl_mvm_thermal_zone_registe > for (i = 0 ; i < IWL_MAX_DTS_TRIPS; i++) { > mvm->tz_device.trips[i].temperature = THERMAL_TEMP_INVALID; > mvm->tz_device.trips[i].type = THERMAL_TRIP_PASSIVE; > + mvm->tz_device.trips[i].flags = THERMAL_TRIP_FLAG_RW_TEMP; > } > mvm->tz_device.tzone = thermal_zone_device_register_with_trips(name, > mvm->tz_device.trips, > IWL_MAX_DTS_TRIPS, > - IWL_WRITABLE_TRIPS_MSK, > + 0, > mvm, &tzone_ops, > NULL, 0, 0); > if (IS_ERR(mvm->tz_device.tzone)) { > > > >
On 12/02/2024 19:38, Rafael J. Wysocki wrote: > From: Rafael J. Wysocki <rafael.j.wysocki@intel.com> > > It is now possible to flag trip points with THERMAL_TRIP_FLAG_RW_TEMP > to allow their temperature to be set from user space via sysfs instead > of using a nonzero writable trips mask during thermal zone registration, > so make the iwlwifi code do that. > > No intentional functional impact. > > Note that this change is requisite for dropping the mask argument from > thermal_zone_device_register_with_trips() going forward. > > Signed-off-by: Rafael J. Wysocki <rafael.j.wysocki@intel.com> > --- Reviewed-by: Daniel Lezcano <daniel.lezcano@linaro.org>
Index: linux-pm/drivers/net/wireless/intel/iwlwifi/mvm/tt.c =================================================================== --- linux-pm.orig/drivers/net/wireless/intel/iwlwifi/mvm/tt.c +++ linux-pm/drivers/net/wireless/intel/iwlwifi/mvm/tt.c @@ -667,9 +667,6 @@ static struct thermal_zone_device_ops t .set_trip_temp = iwl_mvm_tzone_set_trip_temp, }; -/* make all trips writable */ -#define IWL_WRITABLE_TRIPS_MSK (BIT(IWL_MAX_DTS_TRIPS) - 1) - static void iwl_mvm_thermal_zone_register(struct iwl_mvm *mvm) { int i, ret; @@ -692,11 +689,12 @@ static void iwl_mvm_thermal_zone_registe for (i = 0 ; i < IWL_MAX_DTS_TRIPS; i++) { mvm->tz_device.trips[i].temperature = THERMAL_TEMP_INVALID; mvm->tz_device.trips[i].type = THERMAL_TRIP_PASSIVE; + mvm->tz_device.trips[i].flags = THERMAL_TRIP_FLAG_RW_TEMP; } mvm->tz_device.tzone = thermal_zone_device_register_with_trips(name, mvm->tz_device.trips, IWL_MAX_DTS_TRIPS, - IWL_WRITABLE_TRIPS_MSK, + 0, mvm, &tzone_ops, NULL, 0, 0); if (IS_ERR(mvm->tz_device.tzone)) {