[v1,05/12] PM: sleep: stats: Use step_failures[0] as a counter of successful cycles
Message ID | 3290637.44csPzL39Z@kreacher |
---|---|
State | New |
Headers |
Return-Path: <linux-kernel+bounces-32955-ouuuleilei=gmail.com@vger.kernel.org> Delivered-To: ouuuleilei@gmail.com Received: by 2002:a05:7301:2bc4:b0:101:a8e8:374 with SMTP id hx4csp2514091dyb; Mon, 22 Jan 2024 03:48:36 -0800 (PST) X-Google-Smtp-Source: AGHT+IGF+DNX3LqC3JGGQCzTC//rjZ5m1Yi/aG3RQChJAUs92Ya1EfleaPP6j6MQBGvr3o8OpIIi X-Received: by 2002:a17:906:3891:b0:a2c:176a:d89d with SMTP id q17-20020a170906389100b00a2c176ad89dmr1769247ejd.146.1705924116357; Mon, 22 Jan 2024 03:48:36 -0800 (PST) ARC-Seal: i=2; a=rsa-sha256; t=1705924116; cv=pass; d=google.com; s=arc-20160816; b=o6QfPTWHuOKMcc5eMArPpRfu+P/aOYSVlJIk+/eGk9kd0bdDxjAcBFDservEAcVl5N LsIJmYZ5Qrbv090V6bcOCYCejv1pjULlm4mjiMIFfYcruYn8j8+YvB1sMF3axvYK7WBx oxy6eR5ThWanMFxE3qH0kornCE2A4mRU/GvVAh0gOeTiHv2ssQ26OxL3Ws8wKsFCGW+J hFAopVGD+JCUuagh0BN11SYMU9puHzOFE4QF5Ss06dh0TlJpXwSKHnPZEYrC8HFJCHKi wCFbe0lb4sAT0sGs87oy0dcQFa55FKfUU8MwHyJa/f4kQcy8vjL1vHdnFAiJBrPz90W+ 81hQ== ARC-Message-Signature: i=2; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816; h=content-transfer-encoding:mime-version:list-unsubscribe :list-subscribe:list-id:precedence:references:in-reply-to:message-id :date:subject:cc:to:from; bh=GSwKrxPG35twycfHRWyCPcl2rYghiW0zokjuOdirfus=; fh=4LIu5opAwLV7NEWuWaesW8kxXXZagKTitwg1cEZexpE=; b=IwtXUaEuLxdPyswfTkW0hfx+xl59vmRQumzDNn74FzR0uAAxo2TyCGCvXG7DDyaVp7 +zQ+/LD0Ejcb3vozI/+BxkevbFxQHC6JUKGHLg1u4oAzdvcaxsRoBJnIRMzBweajEuN3 vbOrYPJCssKad/E+vZ7HWvuPc89Lng72j2/rbtggKSTqa2ddkRS18Lty/Oi5vOws0zLJ XQfjhMvYf1TYH4t6uMNReb/YIs+LfqcAi+4IqrWP8D9+IWy4V5nu1CGLf/cSM80x5nIb ZQd8ncUUeqU3nsu5DRZCT3wryzb+DT2HVhaS3oO/77HHoUuMKojbR76D+fAnHbsH1AHN Sc0g== ARC-Authentication-Results: i=2; mx.google.com; arc=pass (i=1 spf=pass spfdomain=rjwysocki.net); spf=pass (google.com: domain of linux-kernel+bounces-32955-ouuuleilei=gmail.com@vger.kernel.org designates 147.75.80.249 as permitted sender) smtp.mailfrom="linux-kernel+bounces-32955-ouuuleilei=gmail.com@vger.kernel.org" Received: from am.mirrors.kernel.org (am.mirrors.kernel.org. [147.75.80.249]) by mx.google.com with ESMTPS id e24-20020a170906081800b00a27a6b2d9casi10524705ejd.519.2024.01.22.03.48.36 for <ouuuleilei@gmail.com> (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Mon, 22 Jan 2024 03:48:36 -0800 (PST) Received-SPF: pass (google.com: domain of linux-kernel+bounces-32955-ouuuleilei=gmail.com@vger.kernel.org designates 147.75.80.249 as permitted sender) client-ip=147.75.80.249; Authentication-Results: mx.google.com; arc=pass (i=1 spf=pass spfdomain=rjwysocki.net); spf=pass (google.com: domain of linux-kernel+bounces-32955-ouuuleilei=gmail.com@vger.kernel.org designates 147.75.80.249 as permitted sender) smtp.mailfrom="linux-kernel+bounces-32955-ouuuleilei=gmail.com@vger.kernel.org" Received: from smtp.subspace.kernel.org (wormhole.subspace.kernel.org [52.25.139.140]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by am.mirrors.kernel.org (Postfix) with ESMTPS id F09361F23F00 for <ouuuleilei@gmail.com>; Mon, 22 Jan 2024 11:48:35 +0000 (UTC) Received: from localhost.localdomain (localhost.localdomain [127.0.0.1]) by smtp.subspace.kernel.org (Postfix) with ESMTP id 3BDD73EA97; Mon, 22 Jan 2024 11:44:36 +0000 (UTC) Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id CFC0A3CF43; Mon, 22 Jan 2024 11:44:28 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; arc=none smtp.client-ip=79.96.170.134 ARC-Seal: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1705923874; cv=none; b=B5BzDkIbJMw1Ymdx211LVM2OqERCER83GPU5NQfNDnarwzarm4QEk9fxDPmqYYnEFRVyQJiycmKakARdaAzVG9EwgL+YfebbG9gnCSK/uhpFtA4iOPZenKnqba3ypsd0Ir/7koTCoEIm7cIhRPqZ0NToceNnMkvt5c2s6l8dFjo= ARC-Message-Signature: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1705923874; c=relaxed/simple; bh=ViL55juQL2yZg0/fut6nXH2YChHT8Lh7HKMvuFfirfg=; h=From:To:Cc:Subject:Date:Message-ID:In-Reply-To:References: MIME-Version:Content-Type; b=cZvj7IZ1t23HnCjfLH513RloxQc7/1A0yeg3Gy/eg7pvEMPOEGpKHCPYb1nvdrjvWNvJw8M14SKai7Y27fyvTGa+ofbhK8zAzGJRkk1ogPboL+n6ILoEA7cQ+qkbo+8bhC8Vpc/vevXLxvXXNLHmXQsIgN6dP9wEYy7uBVNo0wE= ARC-Authentication-Results: i=1; smtp.subspace.kernel.org; dmarc=none (p=none dis=none) header.from=rjwysocki.net; spf=pass smtp.mailfrom=rjwysocki.net; arc=none smtp.client-ip=79.96.170.134 Authentication-Results: smtp.subspace.kernel.org; dmarc=none (p=none dis=none) header.from=rjwysocki.net Authentication-Results: smtp.subspace.kernel.org; spf=pass smtp.mailfrom=rjwysocki.net Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.4.0) id 573e3b755b40b71a; Mon, 22 Jan 2024 12:44:26 +0100 Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by cloudserver094114.home.pl (Postfix) with ESMTPSA id 28093669540; Mon, 22 Jan 2024 12:44:26 +0100 (CET) From: "Rafael J. Wysocki" <rjw@rjwysocki.net> To: Linux PM <linux-pm@vger.kernel.org> Cc: LKML <linux-kernel@vger.kernel.org>, Ulf Hansson <ulf.hansson@linaro.org>, Stanislaw Gruszka <stanislaw.gruszka@linux.intel.com> Subject: [PATCH v1 05/12] PM: sleep: stats: Use step_failures[0] as a counter of successful cycles Date: Mon, 22 Jan 2024 12:29:11 +0100 Message-ID: <3290637.44csPzL39Z@kreacher> In-Reply-To: <5760158.DvuYhMxLoT@kreacher> References: <5760158.DvuYhMxLoT@kreacher> Precedence: bulk X-Mailing-List: linux-kernel@vger.kernel.org List-Id: <linux-kernel.vger.kernel.org> List-Subscribe: <mailto:linux-kernel+subscribe@vger.kernel.org> List-Unsubscribe: <mailto:linux-kernel+unsubscribe@vger.kernel.org> MIME-Version: 1.0 Content-Transfer-Encoding: 7Bit Content-Type: text/plain; charset="UTF-8" X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedvkedrvdekiedgfedtucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffqoffgrffnpdggtffipffknecuuegrihhlohhuthemucduhedtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvfevufffkfgjfhgggfgtsehtufertddttdejnecuhfhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqnecuggftrfgrthhtvghrnhepvdffueeitdfgvddtudegueejtdffteetgeefkeffvdeftddttdeuhfegfedvjefhnecukfhppeduleehrddufeeirdduledrleegnecuvehluhhsthgvrhfuihiivgepudenucfrrghrrghmpehinhgvthepudelhedrudefiedrudelrdelgedphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqedpnhgspghrtghpthhtohepgedprhgtphhtthhopehlihhnuhigqdhpmhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdhkvghrnhgvlhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehulhhfrdhhrghnshhsohhnsehlihhnrghrohdrohhrghdprhgtphhtthhopehsthgrnhhishhlrgifrdhgrhhushiikhgrsehlihhnuhigrdhinhhtvghlrdgtohhm X-DCC--Metrics: v370.home.net.pl 1024; Body=4 Fuz1=4 Fuz2=4 X-getmail-retrieved-from-mailbox: INBOX X-GMAIL-THRID: 1788791086082483427 X-GMAIL-MSGID: 1788791086082483427 |
Series |
PM: sleep: Fix up suspend stats handling and clean up core code
|
|
Commit Message
Rafael J. Wysocki
Jan. 22, 2024, 11:29 a.m. UTC
From: Rafael J. Wysocki <rafael.j.wysocki@intel.com> The first (index 0) cell of the step_failures[] array in struct suspend_stats introduced previously can be used as a counter of successful suspend-resume cycles instead of the separate "success" field in it, so do that. While at it, change the type of the "fail" field in struct suspend_stats to unsigned int, because it cannot be negative. No intentional functional impact. Signed-off-by: Rafael J. Wysocki <rafael.j.wysocki@intel.com> --- include/linux/suspend.h | 3 +-- kernel/power/main.c | 9 +++++---- kernel/power/suspend.c | 2 +- 3 files changed, 7 insertions(+), 7 deletions(-)
Comments
On Mon, Jan 22, 2024 at 12:29:11PM +0100, Rafael J. Wysocki wrote: > From: Rafael J. Wysocki <rafael.j.wysocki@intel.com> > > The first (index 0) cell of the step_failures[] array in struct > suspend_stats introduced previously can be used as a counter of > successful suspend-resume cycles instead of the separate "success" > field in it, so do that. > > While at it, change the type of the "fail" field in struct > suspend_stats to unsigned int, because it cannot be negative. > > No intentional functional impact. > > Signed-off-by: Rafael J. Wysocki <rafael.j.wysocki@intel.com> > --- > include/linux/suspend.h | 3 +-- > kernel/power/main.c | 9 +++++---- > kernel/power/suspend.c | 2 +- > 3 files changed, 7 insertions(+), 7 deletions(-) > > Index: linux-pm/include/linux/suspend.h > =================================================================== > --- linux-pm.orig/include/linux/suspend.h > +++ linux-pm/include/linux/suspend.h > @@ -55,8 +55,7 @@ enum suspend_stat_step { > > struct suspend_stats { > unsigned int step_failures[SUSPEND_NR_STEPS]; > - int success; <snip> > - suspend_stats.success, suspend_stats.fail); > + seq_printf(s, "success: %u\nfail: %u\n", > + suspend_stats.step_failures[SUSPEND_NONE], > + suspend_stats.fail); > > for (step = SUSPEND_FREEZE; step < SUSPEND_NR_STEPS; step++) > seq_printf(s, "failed_%s: %u\n", suspend_step_names[step], > Index: linux-pm/kernel/power/suspend.c > =================================================================== > --- linux-pm.orig/kernel/power/suspend.c > +++ linux-pm/kernel/power/suspend.c > @@ -620,7 +620,7 @@ int pm_suspend(suspend_state_t state) > suspend_stats.fail++; > dpm_save_failed_errno(error); > } else { > - suspend_stats.success++; > + suspend_stats.step_failures[SUSPEND_NONE]++; This looks confusing for me. I think would be better keep success field and just remove SUSPEND_NONE from the suspend_stat_step and suspend_stat_names. Actually do not introduce it, SUSPEND_NONE does not seems to be necessary (SUSPEND_FREEZE can be 0). Regards Stanislaw
On Thu, Jan 25, 2024 at 8:52 AM Stanislaw Gruszka <stanislaw.gruszka@linux.intel.com> wrote: > > On Mon, Jan 22, 2024 at 12:29:11PM +0100, Rafael J. Wysocki wrote: > > From: Rafael J. Wysocki <rafael.j.wysocki@intel.com> > > > > The first (index 0) cell of the step_failures[] array in struct > > suspend_stats introduced previously can be used as a counter of > > successful suspend-resume cycles instead of the separate "success" > > field in it, so do that. > > > > While at it, change the type of the "fail" field in struct > > suspend_stats to unsigned int, because it cannot be negative. > > > > No intentional functional impact. > > > > Signed-off-by: Rafael J. Wysocki <rafael.j.wysocki@intel.com> > > --- > > include/linux/suspend.h | 3 +-- > > kernel/power/main.c | 9 +++++---- > > kernel/power/suspend.c | 2 +- > > 3 files changed, 7 insertions(+), 7 deletions(-) > > > > Index: linux-pm/include/linux/suspend.h > > =================================================================== > > --- linux-pm.orig/include/linux/suspend.h > > +++ linux-pm/include/linux/suspend.h > > @@ -55,8 +55,7 @@ enum suspend_stat_step { > > > > struct suspend_stats { > > unsigned int step_failures[SUSPEND_NR_STEPS]; > > - int success; > <snip> > > - suspend_stats.success, suspend_stats.fail); > > + seq_printf(s, "success: %u\nfail: %u\n", > > + suspend_stats.step_failures[SUSPEND_NONE], > > + suspend_stats.fail); > > > > for (step = SUSPEND_FREEZE; step < SUSPEND_NR_STEPS; step++) > > seq_printf(s, "failed_%s: %u\n", suspend_step_names[step], > > Index: linux-pm/kernel/power/suspend.c > > =================================================================== > > --- linux-pm.orig/kernel/power/suspend.c > > +++ linux-pm/kernel/power/suspend.c > > @@ -620,7 +620,7 @@ int pm_suspend(suspend_state_t state) > > suspend_stats.fail++; > > dpm_save_failed_errno(error); > > } else { > > - suspend_stats.success++; > > + suspend_stats.step_failures[SUSPEND_NONE]++; > > This looks confusing for me. I think would be better keep > success field and just remove SUSPEND_NONE from the > suspend_stat_step and suspend_stat_names. Actually do > not introduce it, SUSPEND_NONE does not seems to be necessary > (SUSPEND_FREEZE can be 0). OK I'll need to rearrange the series for that somewhat except for the first two patches. I guess it's OK to retain the R-by tags? Thanks for all of the reviews!
On Thu, Jan 25, 2024 at 04:11:08PM +0100, Rafael J. Wysocki wrote: > On Thu, Jan 25, 2024 at 8:52 AM Stanislaw Gruszka > <stanislaw.gruszka@linux.intel.com> wrote: > > > > On Mon, Jan 22, 2024 at 12:29:11PM +0100, Rafael J. Wysocki wrote: > > > From: Rafael J. Wysocki <rafael.j.wysocki@intel.com> > > > > > > The first (index 0) cell of the step_failures[] array in struct > > > suspend_stats introduced previously can be used as a counter of > > > successful suspend-resume cycles instead of the separate "success" > > > field in it, so do that. > > > > > > While at it, change the type of the "fail" field in struct > > > suspend_stats to unsigned int, because it cannot be negative. > > > > > > No intentional functional impact. > > > > > > Signed-off-by: Rafael J. Wysocki <rafael.j.wysocki@intel.com> > > > --- > > > include/linux/suspend.h | 3 +-- > > > kernel/power/main.c | 9 +++++---- > > > kernel/power/suspend.c | 2 +- > > > 3 files changed, 7 insertions(+), 7 deletions(-) > > > > > > Index: linux-pm/include/linux/suspend.h > > > =================================================================== > > > --- linux-pm.orig/include/linux/suspend.h > > > +++ linux-pm/include/linux/suspend.h > > > @@ -55,8 +55,7 @@ enum suspend_stat_step { > > > > > > struct suspend_stats { > > > unsigned int step_failures[SUSPEND_NR_STEPS]; > > > - int success; > > <snip> > > > - suspend_stats.success, suspend_stats.fail); > > > + seq_printf(s, "success: %u\nfail: %u\n", > > > + suspend_stats.step_failures[SUSPEND_NONE], > > > + suspend_stats.fail); > > > > > > for (step = SUSPEND_FREEZE; step < SUSPEND_NR_STEPS; step++) > > > seq_printf(s, "failed_%s: %u\n", suspend_step_names[step], > > > Index: linux-pm/kernel/power/suspend.c > > > =================================================================== > > > --- linux-pm.orig/kernel/power/suspend.c > > > +++ linux-pm/kernel/power/suspend.c > > > @@ -620,7 +620,7 @@ int pm_suspend(suspend_state_t state) > > > suspend_stats.fail++; > > > dpm_save_failed_errno(error); > > > } else { > > > - suspend_stats.success++; > > > + suspend_stats.step_failures[SUSPEND_NONE]++; > > > > This looks confusing for me. I think would be better keep > > success field and just remove SUSPEND_NONE from the > > suspend_stat_step and suspend_stat_names. Actually do > > not introduce it, SUSPEND_NONE does not seems to be necessary > > (SUSPEND_FREEZE can be 0). > > OK > > I'll need to rearrange the series for that somewhat except for the > first two patches. I wouldn't mind to skip this change and just remove SUSPEND_NONE in separate patch. > I guess it's OK to retain the R-by tags? Yes, is OK. Regards Stanislaw
Index: linux-pm/include/linux/suspend.h =================================================================== --- linux-pm.orig/include/linux/suspend.h +++ linux-pm/include/linux/suspend.h @@ -55,8 +55,7 @@ enum suspend_stat_step { struct suspend_stats { unsigned int step_failures[SUSPEND_NR_STEPS]; - int success; - int fail; + unsigned int fail; #define REC_FAILED_NUM 2 int last_failed_dev; char failed_devs[REC_FAILED_NUM][40]; Index: linux-pm/kernel/power/main.c =================================================================== --- linux-pm.orig/kernel/power/main.c +++ linux-pm/kernel/power/main.c @@ -339,8 +339,7 @@ static ssize_t _name##_show(struct kobje } \ static struct kobj_attribute _name = __ATTR_RO(_name) -suspend_attr(success, "%d\n"); -suspend_attr(fail, "%d\n"); +suspend_attr(fail, "%u\n"); suspend_attr(last_hw_sleep, "%llu\n"); suspend_attr(total_hw_sleep, "%llu\n"); suspend_attr(max_hw_sleep, "%llu\n"); @@ -354,6 +353,7 @@ static ssize_t _name##_show(struct kobje } \ static struct kobj_attribute _name = __ATTR_RO(_name) +suspend_step_attr(success, SUSPEND_NONE); suspend_step_attr(failed_freeze, SUSPEND_FREEZE); suspend_step_attr(failed_prepare, SUSPEND_PREPARE); suspend_step_attr(failed_suspend, SUSPEND_SUSPEND); @@ -458,8 +458,9 @@ static int suspend_stats_show(struct seq last_step = suspend_stats.last_failed_step + REC_FAILED_NUM - 1; last_step %= REC_FAILED_NUM; - seq_printf(s, "success: %d\nfail: %d\n", - suspend_stats.success, suspend_stats.fail); + seq_printf(s, "success: %u\nfail: %u\n", + suspend_stats.step_failures[SUSPEND_NONE], + suspend_stats.fail); for (step = SUSPEND_FREEZE; step < SUSPEND_NR_STEPS; step++) seq_printf(s, "failed_%s: %u\n", suspend_step_names[step], Index: linux-pm/kernel/power/suspend.c =================================================================== --- linux-pm.orig/kernel/power/suspend.c +++ linux-pm/kernel/power/suspend.c @@ -620,7 +620,7 @@ int pm_suspend(suspend_state_t state) suspend_stats.fail++; dpm_save_failed_errno(error); } else { - suspend_stats.success++; + suspend_stats.step_failures[SUSPEND_NONE]++; } pr_info("suspend exit\n"); return error;