Message ID | 3256881.aeNJFYEL58@kreacher |
---|---|
State | New |
Headers |
Return-Path: <linux-kernel-owner@vger.kernel.org> Delivered-To: ouuuleilei@gmail.com Received: by 2002:a59:a888:0:b0:403:3b70:6f57 with SMTP id x8csp499169vqo; Fri, 6 Oct 2023 10:52:17 -0700 (PDT) X-Google-Smtp-Source: AGHT+IFT7GRpq4zh8u18Ha7v6382Y5R5xel0B/BvCOYAkBNzmST2F2MoChvBUHDHHDuv3mqHHBvt X-Received: by 2002:a17:902:e888:b0:1c7:37e2:13fe with SMTP id w8-20020a170902e88800b001c737e213femr9808016plg.2.1696614737478; Fri, 06 Oct 2023 10:52:17 -0700 (PDT) ARC-Seal: i=1; a=rsa-sha256; t=1696614737; cv=none; d=google.com; s=arc-20160816; b=YhxFbn2BrCmXghEMbNtMznWCSzEMyd4yjaN3/Kbs/CZkLoUOb36CevJvmf9d6sOQ9y ttr2XmYdZN2e05cX8M+CshjAl4OOV/FY27coUHoP1m5l3QJwkIuDKiCcJaqOQeRLrjgF YEXUcjCTvbw5DHfb6+mdtR5rh4JXr1xbKishIMlefEWQTfzPtAdqLoUOg2FX25q9yTlI fF8y1X7s6ZHwsqcI8ecJiym3gLUk73sFUm3bfIgusma/80zGSTRv4XdlUXJgodsIfetX 7Sczz6w5+5AE2VXH+mqcYKjHFx83S18Rg8hA4M8kOPcTNwXv8l1MzlVLGo9k3+L4XBwt ZNtQ== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816; h=list-id:precedence:content-transfer-encoding:mime-version :references:in-reply-to:message-id:date:subject:cc:to:from; bh=DlHCI25g2T/r7xRbwh8RipYzcnaZb3rCgd610m6cBC4=; fh=7MtGe3Dn5wgXLQQm5DZb5OyhwmEFEEdRNCLYMJcP5yE=; b=zGlMwigpwoY4OELbmkpEREpgtcpupmfGtW7RIAjou6oKO+lNKNENUbHctAVpVmxHU7 v3TIK4wHKsze33/Rt9XzHclK2rvpMijAFjd5/BGqLA3zlrqjLldRaOdU4pXNNb1v1JUo /HSVPIIG/fvdLCU3SrFBnwRWtxjPl+3VoZCEwWTOWn0B5PdrSHQbTlKdzNAHwjbDM79u 2Gb75UqHPz2DAScXh0aNt5wCotN6QPMTmi0IWjlj6xXr6IAVJonROoDi/jTvegWXm/qr YGfFdmX5Dxqp7npVk3ipL7kp7mWLNkkQkZAmJh5VGceWH+qgr9GV4c7KXdVBok0oZxbf r65A== ARC-Authentication-Results: i=1; mx.google.com; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::3:4 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Received: from howler.vger.email (howler.vger.email. [2620:137:e000::3:4]) by mx.google.com with ESMTPS id d2-20020a170902cec200b001c61226fe40si4455992plg.392.2023.10.06.10.52.17 (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Fri, 06 Oct 2023 10:52:17 -0700 (PDT) Received-SPF: pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::3:4 as permitted sender) client-ip=2620:137:e000::3:4; Authentication-Results: mx.google.com; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::3:4 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Received: from out1.vger.email (depot.vger.email [IPv6:2620:137:e000::3:0]) by howler.vger.email (Postfix) with ESMTP id 47AFF89630E1; Fri, 6 Oct 2023 10:52:13 -0700 (PDT) X-Virus-Status: Clean X-Virus-Scanned: clamav-milter 0.103.10 at howler.vger.email Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S233127AbjJFRvq (ORCPT <rfc822;ezelljr.billy@gmail.com> + 18 others); Fri, 6 Oct 2023 13:51:46 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:35806 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S232953AbjJFRvd (ORCPT <rfc822;linux-kernel@vger.kernel.org>); Fri, 6 Oct 2023 13:51:33 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id 2DD5DB6; Fri, 6 Oct 2023 10:51:32 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id ad6d2b9f66b12151; Fri, 6 Oct 2023 19:51:30 +0200 Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id 30F1D665D08; Fri, 6 Oct 2023 19:51:30 +0200 (CEST) From: "Rafael J. Wysocki" <rjw@rjwysocki.net> To: Linux PM <linux-pm@vger.kernel.org> Cc: LKML <linux-kernel@vger.kernel.org>, Daniel Lezcano <daniel.lezcano@linaro.org>, Srinivas Pandruvada <srinivas.pandruvada@linux.intel.com>, Zhang Rui <rui.zhang@intel.com>, Lukasz Luba <lukasz.luba@arm.com> Subject: [PATCH v1 1/6] thermal: trip: Simplify computing trip indices Date: Fri, 06 Oct 2023 19:40:25 +0200 Message-ID: <3256881.aeNJFYEL58@kreacher> In-Reply-To: <13365827.uLZWGnKmhe@kreacher> References: <13365827.uLZWGnKmhe@kreacher> MIME-Version: 1.0 Content-Transfer-Encoding: 7Bit Content-Type: text/plain; charset="UTF-8" X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedvkedrgeeigdduudehucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffqoffgrffnpdggtffipffknecuuegrihhlohhuthemucduhedtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvfevufffkfgjfhgggfgtsehtufertddttdejnecuhfhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqnecuggftrfgrthhtvghrnhepvdffueeitdfgvddtudegueejtdffteetgeefkeffvdeftddttdeuhfegfedvjefhnecukfhppeduleehrddufeeirdduledrleegnecuvehluhhsthgvrhfuihiivgepudenucfrrghrrghmpehinhgvthepudelhedrudefiedrudelrdelgedphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqedpnhgspghrtghpthhtohepiedprhgtphhtthhopehlihhnuhigqdhpmhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdhkvghrnhgvlhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopegurghnihgvlhdrlhgviigtrghnoheslhhinhgrrhhordhorhhgpdhrtghpthhtohepshhrihhnihhvrghsrdhprghnughruhhvrggurgeslhhinhhugidrihhnthgv lhdrtghomhdprhgtphhtthhopehruhhirdiihhgrnhhgsehinhhtvghlrdgtohhmpdhrtghpthhtoheplhhukhgrshiirdhluhgsrgesrghrmhdrtghomh X-DCC--Metrics: v370.home.net.pl 1024; Body=6 Fuz1=6 Fuz2=6 X-Spam-Status: No, score=2.8 required=5.0 tests=HEADER_FROM_DIFFERENT_DOMAINS, MAILING_LIST_MULTI,RCVD_IN_SBL_CSS,SPF_HELO_NONE,SPF_PASS autolearn=no autolearn_force=no version=3.4.6 X-Spam-Checker-Version: SpamAssassin 3.4.6 (2021-04-09) on howler.vger.email Precedence: bulk List-ID: <linux-kernel.vger.kernel.org> X-Mailing-List: linux-kernel@vger.kernel.org X-Greylist: Sender passed SPF test, not delayed by milter-greylist-4.6.4 (howler.vger.email [0.0.0.0]); Fri, 06 Oct 2023 10:52:13 -0700 (PDT) X-Spam-Level: ** X-getmail-retrieved-from-mailbox: INBOX X-GMAIL-THRID: 1779029495094794353 X-GMAIL-MSGID: 1779029495094794353 |
Series |
thermal: core: Pass trip pointers to governor .throttle() callbacks
|
|
Commit Message
Rafael J. Wysocki
Oct. 6, 2023, 5:40 p.m. UTC
From: Rafael J. Wysocki <rafael.j.wysocki@intel.com> A trip index can be computed right away as a difference between the value of a trip pointer pointing to the given trip object and the start of the trips[] table in the thermal zone containing the trip, so change thermal_zone_trip_id() accordingly. No intentional functional impact (except for some speedup). Signed-off-by: Rafael J. Wysocki <rafael.j.wysocki@intel.com> --- drivers/thermal/thermal_trip.c | 13 +++++-------- 1 file changed, 5 insertions(+), 8 deletions(-)
Comments
On 06/10/2023 19:40, Rafael J. Wysocki wrote: > From: Rafael J. Wysocki <rafael.j.wysocki@intel.com> > > A trip index can be computed right away as a difference between the > value of a trip pointer pointing to the given trip object and the > start of the trips[] table in the thermal zone containing the trip, so > change thermal_zone_trip_id() accordingly. > > No intentional functional impact (except for some speedup). > > Signed-off-by: Rafael J. Wysocki <rafael.j.wysocki@intel.com> > --- > drivers/thermal/thermal_trip.c | 13 +++++-------- > 1 file changed, 5 insertions(+), 8 deletions(-) > > Index: linux-pm/drivers/thermal/thermal_trip.c > =================================================================== > --- linux-pm.orig/drivers/thermal/thermal_trip.c > +++ linux-pm/drivers/thermal/thermal_trip.c > @@ -175,14 +175,11 @@ int thermal_zone_set_trip(struct thermal > int thermal_zone_trip_id(struct thermal_zone_device *tz, > const struct thermal_trip *trip) > { > - int i; > - > lockdep_assert_held(&tz->lock); > > - for (i = 0; i < tz->num_trips; i++) { > - if (&tz->trips[i] == trip) > - return i; > - } > - > - return -ENODATA; > + /* > + * Assume the trip to be located within the bounds of the thermal > + * zone's trips[] table. > + */ > + return trip - tz->trips; Shouldn't be divided by sizeof(*trip) ? > } > > >
On Thu, Oct 12, 2023 at 4:27 PM Daniel Lezcano <daniel.lezcano@linaro.org> wrote: > > On 06/10/2023 19:40, Rafael J. Wysocki wrote: > > From: Rafael J. Wysocki <rafael.j.wysocki@intel.com> > > > > A trip index can be computed right away as a difference between the > > value of a trip pointer pointing to the given trip object and the > > start of the trips[] table in the thermal zone containing the trip, so > > change thermal_zone_trip_id() accordingly. > > > > No intentional functional impact (except for some speedup). > > > > Signed-off-by: Rafael J. Wysocki <rafael.j.wysocki@intel.com> > > --- > > drivers/thermal/thermal_trip.c | 13 +++++-------- > > 1 file changed, 5 insertions(+), 8 deletions(-) > > > > Index: linux-pm/drivers/thermal/thermal_trip.c > > =================================================================== > > --- linux-pm.orig/drivers/thermal/thermal_trip.c > > +++ linux-pm/drivers/thermal/thermal_trip.c > > @@ -175,14 +175,11 @@ int thermal_zone_set_trip(struct thermal > > int thermal_zone_trip_id(struct thermal_zone_device *tz, > > const struct thermal_trip *trip) > > { > > - int i; > > - > > lockdep_assert_held(&tz->lock); > > > > - for (i = 0; i < tz->num_trips; i++) { > > - if (&tz->trips[i] == trip) > > - return i; > > - } > > - > > - return -ENODATA; > > + /* > > + * Assume the trip to be located within the bounds of the thermal > > + * zone's trips[] table. > > + */ > > + return trip - tz->trips; > > Shouldn't be divided by sizeof(*trip) ? No, it's in sizeof(*trip) units already.
On 10/6/23 18:40, Rafael J. Wysocki wrote: > From: Rafael J. Wysocki <rafael.j.wysocki@intel.com> > > A trip index can be computed right away as a difference between the > value of a trip pointer pointing to the given trip object and the > start of the trips[] table in the thermal zone containing the trip, so > change thermal_zone_trip_id() accordingly. > > No intentional functional impact (except for some speedup). > > Signed-off-by: Rafael J. Wysocki <rafael.j.wysocki@intel.com> > --- > drivers/thermal/thermal_trip.c | 13 +++++-------- > 1 file changed, 5 insertions(+), 8 deletions(-) > > Index: linux-pm/drivers/thermal/thermal_trip.c > =================================================================== > --- linux-pm.orig/drivers/thermal/thermal_trip.c > +++ linux-pm/drivers/thermal/thermal_trip.c > @@ -175,14 +175,11 @@ int thermal_zone_set_trip(struct thermal > int thermal_zone_trip_id(struct thermal_zone_device *tz, > const struct thermal_trip *trip) > { > - int i; > - > lockdep_assert_held(&tz->lock); > > - for (i = 0; i < tz->num_trips; i++) { > - if (&tz->trips[i] == trip) > - return i; > - } > - > - return -ENODATA; > + /* > + * Assume the trip to be located within the bounds of the thermal > + * zone's trips[] table. > + */ > + return trip - tz->trips; > } > > > I agree wit hthe comment, we should be safe here, since we control that array. I could be a bit picky about this 'int' return in that function on 64bit kernels, were we have also ptrdiff_t set to long IIRC. But this particular usage should be handled properly in all our cases, so: Reviewed-by: Lukasz Luba <lukasz.luba@arm.com> Tested-by: Lukasz Luba <lukasz.luba@arm.com>
On Fri, Oct 20, 2023 at 6:58 PM Lukasz Luba <lukasz.luba@arm.com> wrote: > > > > On 10/6/23 18:40, Rafael J. Wysocki wrote: > > From: Rafael J. Wysocki <rafael.j.wysocki@intel.com> > > > > A trip index can be computed right away as a difference between the > > value of a trip pointer pointing to the given trip object and the > > start of the trips[] table in the thermal zone containing the trip, so > > change thermal_zone_trip_id() accordingly. > > > > No intentional functional impact (except for some speedup). > > > > Signed-off-by: Rafael J. Wysocki <rafael.j.wysocki@intel.com> > > --- > > drivers/thermal/thermal_trip.c | 13 +++++-------- > > 1 file changed, 5 insertions(+), 8 deletions(-) > > > > Index: linux-pm/drivers/thermal/thermal_trip.c > > =================================================================== > > --- linux-pm.orig/drivers/thermal/thermal_trip.c > > +++ linux-pm/drivers/thermal/thermal_trip.c > > @@ -175,14 +175,11 @@ int thermal_zone_set_trip(struct thermal > > int thermal_zone_trip_id(struct thermal_zone_device *tz, > > const struct thermal_trip *trip) > > { > > - int i; > > - > > lockdep_assert_held(&tz->lock); > > > > - for (i = 0; i < tz->num_trips; i++) { > > - if (&tz->trips[i] == trip) > > - return i; > > - } > > - > > - return -ENODATA; > > + /* > > + * Assume the trip to be located within the bounds of the thermal > > + * zone's trips[] table. > > + */ > > + return trip - tz->trips; > > } > > > > > > > > I agree wit hthe comment, we should be safe here, since we control that > array. > > I could be a bit picky about this 'int' return in that function on > 64bit kernels, were we have also ptrdiff_t set to long IIRC. But this > particular usage should be handled properly in all our cases, so: > > Reviewed-by: Lukasz Luba <lukasz.luba@arm.com> > Tested-by: Lukasz Luba <lukasz.luba@arm.com> Thanks!
Index: linux-pm/drivers/thermal/thermal_trip.c =================================================================== --- linux-pm.orig/drivers/thermal/thermal_trip.c +++ linux-pm/drivers/thermal/thermal_trip.c @@ -175,14 +175,11 @@ int thermal_zone_set_trip(struct thermal int thermal_zone_trip_id(struct thermal_zone_device *tz, const struct thermal_trip *trip) { - int i; - lockdep_assert_held(&tz->lock); - for (i = 0; i < tz->num_trips; i++) { - if (&tz->trips[i] == trip) - return i; - } - - return -ENODATA; + /* + * Assume the trip to be located within the bounds of the thermal + * zone's trips[] table. + */ + return trip - tz->trips; }