Message ID | 5725069.DvuYhMxLoT@kreacher |
---|---|
State | New |
Headers |
Return-Path: <linux-kernel-owner@vger.kernel.org> Delivered-To: ouuuleilei@gmail.com Received: by 2002:a59:a888:0:b0:403:3b70:6f57 with SMTP id x8csp876299vqo; Sat, 7 Oct 2023 04:36:44 -0700 (PDT) X-Google-Smtp-Source: AGHT+IFix4Z1dU87xs8U2eoh3ostxYf+sVXS2F6Bb1Gi6JfkztsublHEddmnPT7CfCh04EtEhSPL X-Received: by 2002:a05:6a20:9189:b0:153:b16e:8db1 with SMTP id v9-20020a056a20918900b00153b16e8db1mr11797202pzd.10.1696678604365; Sat, 07 Oct 2023 04:36:44 -0700 (PDT) ARC-Seal: i=1; a=rsa-sha256; t=1696678604; cv=none; d=google.com; s=arc-20160816; b=RTHS1lxfOYBVe8b87aLqOeOu3YjYuNBX/Q4ZoPxNuexTcS/AdtTgrbaGzDBt6fRD/4 EEiCYLDFg/QnOQTCkmJ2PNqLyjbHCOn6VKdNvC7gVFO/U+NSMeZU5p21naLkkTvCZDkb +vYzi7PHd6FNTVI2rhc//lu1w8obOPOZrMn7EAKbI8xOYucflmeWBaVHpKahBOAwWtcN 8X6e9prKkCFcvV/+oy4vdbKUoCdGmZuCWNAduYdxDTobmkmjk1gt2O+G8GQauIxwaF1i NzdwNeOJud6zuIEoEj+k09rSu1gld9obm9jPLR3fLfCzFFEZV1AjHVm2p2iAOp5FrBvm FRHg== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816; h=list-id:precedence:content-transfer-encoding:mime-version :message-id:date:subject:cc:to:from; bh=Hn+O5kTKLokDw120uLmDZEn1y6fgzdFKQWjlUD0lUGk=; fh=7XVLT14gs8rGdbFWNNdt1jxKnQDlzczr3hHIv2NTOZ0=; b=CmqG2BiG6ktLhKN9RCDv+oaR8vJwOKJ+6HZWxEhGaPqlGz38xNHkJfgK24ZMY8trL5 Hww/Z6uGEetpeLjjeTU4gPWVs2fwgPeItnBcmkkjZ/724yu430W8Zxfj11jZIxMV5d9n RLyfKQVVZPYOUDREezD06pwizpT40R0KjD2lIBbuvGfVL1DoOza8f+e/jcPqBPVZJzlI U+JlNF03CbJ8ZHtsCMmnSNfSaqmDCYaubeY0tFryI0UuD1OKUnk4723sF/RAj3cMWWC6 TxQraZcLjiCmo657XnUB/SoNQlEO33o746wLz+xRCkNwwa6Dm+eXt2YkYrvB/ZRb3hXu //ow== ARC-Authentication-Results: i=1; mx.google.com; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 23.128.96.32 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Received: from agentk.vger.email (agentk.vger.email. [23.128.96.32]) by mx.google.com with ESMTPS id f20-20020a056a001ad400b0068ff741579fsi3399462pfv.318.2023.10.07.04.36.44 (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Sat, 07 Oct 2023 04:36:44 -0700 (PDT) Received-SPF: pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 23.128.96.32 as permitted sender) client-ip=23.128.96.32; Authentication-Results: mx.google.com; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 23.128.96.32 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Received: from out1.vger.email (depot.vger.email [IPv6:2620:137:e000::3:0]) by agentk.vger.email (Postfix) with ESMTP id 2B78C80D1585; Sat, 7 Oct 2023 04:36:42 -0700 (PDT) X-Virus-Status: Clean X-Virus-Scanned: clamav-milter 0.103.10 at agentk.vger.email Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S1343878AbjJGLgd (ORCPT <rfc822;ezelljr.billy@gmail.com> + 18 others); Sat, 7 Oct 2023 07:36:33 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:55440 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S234148AbjJGLgc (ORCPT <rfc822;linux-kernel@vger.kernel.org>); Sat, 7 Oct 2023 07:36:32 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id E3D96BD; Sat, 7 Oct 2023 04:36:29 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id b51d04623ba10436; Sat, 7 Oct 2023 13:36:28 +0200 Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id DF0816621FA; Sat, 7 Oct 2023 13:36:27 +0200 (CEST) From: "Rafael J. Wysocki" <rjw@rjwysocki.net> To: Linux PM <linux-pm@vger.kernel.org>, Daniel Lezcano <daniel.lezcano@linaro.org> Cc: "Rafael J. Wysocki" <rafael@kernel.org>, Srinivas Pandruvada <srinivas.pandruvada@linux.intel.com>, Zhang Rui <rui.zhang@intel.com>, LKML <linux-kernel@vger.kernel.org>, Rob Herring <robh+dt@kernel.org>, Krzysztof Kozlowski <krzysztof.kozlowski+dt@linaro.org>, devicetree@vger.kernel.org, Lukasz Luba <lukasz.luba@arm.com>, Amit Kucheria <amitk@kernel.org> Subject: [PATCH v3] thermal: Remove Amit Kucheria from MAINTAINERS Date: Sat, 07 Oct 2023 13:36:27 +0200 Message-ID: <5725069.DvuYhMxLoT@kreacher> MIME-Version: 1.0 Content-Transfer-Encoding: 7Bit Content-Type: text/plain; charset="UTF-8" X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedvkedrgeelgdegvdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffogffrnfdpggftiffpkfenuceurghilhhouhhtmecuudehtdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvvefufffkggfgtgesthfuredttddtjeenucfhrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqeenucggtffrrghtthgvrhhnpeefvddtfeffveeguefgtdeiuddtieelheegkefhhefgkeefuddutdehgfdvudduieenucffohhmrghinhepuggvvhhitggvthhrvggvrdhorhhgnecukfhppeduleehrddufeeirdduledrleegnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepudelhedrudefiedrudelrdelgedphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqedpnhgspghrtghpthhtohepuddupdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtohepuggrnhhivghlrdhlvgiitggrnhhosehlihhnrghrohdrohhrghdprhgtphhtthhopehrrghfrggvlheskhgvrhhnvghlrdhorhhgpdhrtghpthhtohepshhrihhnihhvrghsrdhprghnughruhhvrggurges lhhinhhugidrihhnthgvlhdrtghomhdprhgtphhtthhopehruhhirdiihhgrnhhgsehinhhtvghlrdgtohhmpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhg X-DCC--Metrics: v370.home.net.pl 1024; Body=11 Fuz1=11 Fuz2=11 X-Spam-Status: No, score=2.8 required=5.0 tests=HEADER_FROM_DIFFERENT_DOMAINS, MAILING_LIST_MULTI,RCVD_IN_SBL_CSS,SPF_HELO_NONE,SPF_PASS autolearn=no autolearn_force=no version=3.4.6 X-Spam-Checker-Version: SpamAssassin 3.4.6 (2021-04-09) on agentk.vger.email Precedence: bulk List-ID: <linux-kernel.vger.kernel.org> X-Mailing-List: linux-kernel@vger.kernel.org X-Greylist: Sender passed SPF test, not delayed by milter-greylist-4.6.4 (agentk.vger.email [0.0.0.0]); Sat, 07 Oct 2023 04:36:42 -0700 (PDT) X-Spam-Level: ** X-getmail-retrieved-from-mailbox: INBOX X-GMAIL-THRID: 1779096464186865109 X-GMAIL-MSGID: 1779096464186865109 |
Series |
[v3] thermal: Remove Amit Kucheria from MAINTAINERS
|
|
Commit Message
Rafael J. Wysocki
Oct. 7, 2023, 11:36 a.m. UTC
From: Rafael J. Wysocki <rafael.j.wysocki@intel.com> Subject: [PATCH v2] thermal: Remove Amit Kucheria from MAINTAINERS Amit Kucheria has not been participating in kernel development in any way or form for quite some time, so it is not useful to list him as a designated reviewer for the thermal subsystem or as the thermal zone DT binding maintainer. Remove him from the THERMAL entry in MAINTAINERS and list Daniel Lezcano as the new thermal zone DT binding maintainer. Signed-off-by: Rafael J. Wysocki <rafael.j.wysocki@intel.com> --- v2 -> v3: List Daniel Lezcano as the thermal zone DT binding maintainer. --- Documentation/devicetree/bindings/thermal/thermal-zones.yaml | 2 +- MAINTAINERS | 1 - 2 files changed, 1 insertion(+), 2 deletions(-)
Comments
On 07/10/2023 13:36, Rafael J. Wysocki wrote: > From: Rafael J. Wysocki <rafael.j.wysocki@intel.com> > Subject: [PATCH v2] thermal: Remove Amit Kucheria from MAINTAINERS > > Amit Kucheria has not been participating in kernel development in any > way or form for quite some time, so it is not useful to list him as a > designated reviewer for the thermal subsystem or as the thermal zone DT > binding maintainer. > > Remove him from the THERMAL entry in MAINTAINERS and list Daniel Lezcano > as the new thermal zone DT binding maintainer. > > Signed-off-by: Rafael J. Wysocki <rafael.j.wysocki@intel.com> > --- Acked-by: Daniel Lezcano <daniel.lezcano@linaro.org>
On 07/10/2023 13:36, Rafael J. Wysocki wrote: > From: Rafael J. Wysocki <rafael.j.wysocki@intel.com> > Subject: [PATCH v2] thermal: Remove Amit Kucheria from MAINTAINERS > > Amit Kucheria has not been participating in kernel development in any > way or form for quite some time, so it is not useful to list him as a > designated reviewer for the thermal subsystem or as the thermal zone DT > binding maintainer. > > Remove him from the THERMAL entry in MAINTAINERS and list Daniel Lezcano > as the new thermal zone DT binding maintainer. > > Signed-off-by: Rafael J. Wysocki <rafael.j.wysocki@intel.com> > --- > > v2 -> v3: List Daniel Lezcano as the thermal zone DT binding maintainer. > > --- Acked-by: Krzysztof Kozlowski <krzysztof.kozlowski@linaro.org> Best regards, Krzysztof
On Sat, Oct 7, 2023 at 6:21 PM Daniel Lezcano <daniel.lezcano@linaro.org> wrote: > > On 07/10/2023 13:36, Rafael J. Wysocki wrote: > > From: Rafael J. Wysocki <rafael.j.wysocki@intel.com> > > Subject: [PATCH v2] thermal: Remove Amit Kucheria from MAINTAINERS > > > > Amit Kucheria has not been participating in kernel development in any > > way or form for quite some time, so it is not useful to list him as a > > designated reviewer for the thermal subsystem or as the thermal zone DT > > binding maintainer. > > > > Remove him from the THERMAL entry in MAINTAINERS and list Daniel Lezcano > > as the new thermal zone DT binding maintainer. > > > > Signed-off-by: Rafael J. Wysocki <rafael.j.wysocki@intel.com> > > --- > > Acked-by: Daniel Lezcano <daniel.lezcano@linaro.org> Acked-by: Amit Kucheria <amitk@kernel.org>
Index: linux-pm/MAINTAINERS =================================================================== --- linux-pm.orig/MAINTAINERS +++ linux-pm/MAINTAINERS @@ -21363,7 +21363,6 @@ F: drivers/media/radio/radio-raremono.c THERMAL M: Rafael J. Wysocki <rafael@kernel.org> M: Daniel Lezcano <daniel.lezcano@linaro.org> -R: Amit Kucheria <amitk@kernel.org> R: Zhang Rui <rui.zhang@intel.com> L: linux-pm@vger.kernel.org S: Supported Index: linux-pm/Documentation/devicetree/bindings/thermal/thermal-zones.yaml =================================================================== --- linux-pm.orig/Documentation/devicetree/bindings/thermal/thermal-zones.yaml +++ linux-pm/Documentation/devicetree/bindings/thermal/thermal-zones.yaml @@ -8,7 +8,7 @@ $schema: http://devicetree.org/meta-sche title: Thermal zone maintainers: - - Amit Kucheria <amitk@kernel.org> + - Daniel Lezcano <daniel.lezcano@linaro.org> description: | Thermal management is achieved in devicetree by describing the sensor hardware