Message ID | 5716404.DvuYhMxLoT@kreacher |
---|---|
State | New |
Headers |
Return-Path: <linux-kernel-owner@vger.kernel.org> Delivered-To: ouuuleilei@gmail.com Received: by 2002:a59:a888:0:b0:403:3b70:6f57 with SMTP id x8csp246290vqo; Fri, 6 Oct 2023 04:23:12 -0700 (PDT) X-Google-Smtp-Source: AGHT+IGlB/6wAR8PwUjvxuUDRwiUpaBDSgCYXAAAGKdVlCFYGw9t6Hxjh18Q4NsnHTCpx9tlqWzB X-Received: by 2002:a05:6a00:2450:b0:693:4108:1eb7 with SMTP id d16-20020a056a00245000b0069341081eb7mr8201138pfj.30.1696591392459; Fri, 06 Oct 2023 04:23:12 -0700 (PDT) ARC-Seal: i=1; a=rsa-sha256; t=1696591392; cv=none; d=google.com; s=arc-20160816; b=LnSA7J93FVkw3z8nwnVv7XR12D7I+JmGRqONYqCe3FaHeYrY/oas8z27NDG1ztGlyD Tax0Y3pTmkXCIpGqjK4bb2NUIbdpzPvV03O8vulxh0vk9av7Dzd+Wv4kzQQa0sWouxYx NeBaw4WWUB4vraeEVieUqLrm9ieldNw48/uQTQDLVbmi40X3YxW328ZqweQ6lGPALnrJ 5zAnZJB4HPlAgPYi9SGg69f2PgvKEmdf7kzNYREU9ImiYK43yLJOsh3Yd/Xbw8sK5KCJ vWFyNrVEf0/wVxKQyjlx3ZydN2bkntCf8kttyyP+FPdgPR+SxyiQbPgWKssLRD80hFbw SjJA== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816; h=list-id:precedence:content-transfer-encoding:mime-version :message-id:date:subject:cc:to:from; bh=CBHWwfL9f0KLZBenA26p2fXpoR8H+7gwkyk5FzeJnus=; fh=LmlPIHR1RgOOviATV2XfkeGc8fOD661rTLqyx0Yoxt4=; b=ILdMfQnvBwfkQ4Koojku7iG4TeI2c+VxTULRWSEtR8ApDQY8/nz44APL3aFixxVknb ry5D2blWPmlYuLl8O9Zr14PZ3lDL1DQei78xVLqti8ww3T2GkfADhZ+hUHIFyFSgYix8 uSZd0tvfCKovj0XEjQ9KddWPwiDlXsGnZJG31bDFLtA8V4b8S4yFxNSRKgagFhjt8pRB H0ehKvXfiiW7Ju3Mme4xBB3te2hRLzCPKubl1R+hYTE8yo8ulW4hTM2Ijx2t759lM8Go OhT4wmSPYarCd4cLRdMRdPPPSGcIIMYKTjJO74vKAk+8ltf6WgKzck6kQr5OE8CpdVJ3 Bnvw== ARC-Authentication-Results: i=1; mx.google.com; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::3:7 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Received: from snail.vger.email (snail.vger.email. [2620:137:e000::3:7]) by mx.google.com with ESMTPS id dw6-20020a056a00368600b0068ace3816d7si1280747pfb.387.2023.10.06.04.23.12 (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Fri, 06 Oct 2023 04:23:12 -0700 (PDT) Received-SPF: pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::3:7 as permitted sender) client-ip=2620:137:e000::3:7; Authentication-Results: mx.google.com; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::3:7 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Received: from out1.vger.email (depot.vger.email [IPv6:2620:137:e000::3:0]) by snail.vger.email (Postfix) with ESMTP id 2A1DA80C5F9B; Fri, 6 Oct 2023 04:21:40 -0700 (PDT) X-Virus-Status: Clean X-Virus-Scanned: clamav-milter 0.103.10 at snail.vger.email Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S232024AbjJFLVc (ORCPT <rfc822;ezelljr.billy@gmail.com> + 18 others); Fri, 6 Oct 2023 07:21:32 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:56392 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S232078AbjJFLVV (ORCPT <rfc822;linux-kernel@vger.kernel.org>); Fri, 6 Oct 2023 07:21:21 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id 04A8F10D; Fri, 6 Oct 2023 04:21:16 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id 9a1c822740487185; Fri, 6 Oct 2023 13:21:15 +0200 Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id 8DA8A665D0E; Fri, 6 Oct 2023 13:21:14 +0200 (CEST) From: "Rafael J. Wysocki" <rjw@rjwysocki.net> To: Linux PM <linux-pm@vger.kernel.org> Cc: "Rafael J. Wysocki" <rafael@kernel.org>, Srinivas Pandruvada <srinivas.pandruvada@linux.intel.com>, Daniel Lezcano <daniel.lezcano@linaro.org>, Zhang Rui <rui.zhang@intel.com>, LKML <linux-kernel@vger.kernel.org>, Rob Herring <robh+dt@kernel.org>, Krzysztof Kozlowski <krzysztof.kozlowski+dt@linaro.org>, devicetree@vger.kernel.org, Lukasz Luba <lukasz.luba@arm.com>, Amit Kucheria <amitk@kernel.org> Subject: [PATCH v1] thermal: Remove Amit Kucheria from MAINTAINERS Date: Fri, 06 Oct 2023 13:21:14 +0200 Message-ID: <5716404.DvuYhMxLoT@kreacher> MIME-Version: 1.0 Content-Transfer-Encoding: 7Bit Content-Type: text/plain; charset="UTF-8" X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedvkedrgeeigdefjecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffogffrnfdpggftiffpkfenuceurghilhhouhhtmecuudehtdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvvefufffkggfgtgesthfuredttddtjeenucfhrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqeenucggtffrrghtthgvrhhnpeefvddtfeffveeguefgtdeiuddtieelheegkefhhefgkeefuddutdehgfdvudduieenucffohhmrghinhepuggvvhhitggvthhrvggvrdhorhhgnecukfhppeduleehrddufeeirdduledrleegnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepudelhedrudefiedrudelrdelgedphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqedpnhgspghrtghpthhtohepuddupdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheprhgrfhgrvghlsehkvghrnhgvlhdrohhrghdprhgtphhtthhopehsrhhinhhivhgrshdrphgrnhgurhhuvhgruggrsehlihhnuhigrdhinhhtvghlrdgtohhmpdhrtghpthhtohepuggrnhhivghlrdhlvgii tggrnhhosehlihhnrghrohdrohhrghdprhgtphhtthhopehruhhirdiihhgrnhhgsehinhhtvghlrdgtohhmpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhg X-DCC--Metrics: v370.home.net.pl 1024; Body=11 Fuz1=11 Fuz2=11 X-Spam-Status: No, score=-1.9 required=5.0 tests=BAYES_00,SPF_HELO_NONE, SPF_PASS autolearn=ham autolearn_force=no version=3.4.6 X-Spam-Checker-Version: SpamAssassin 3.4.6 (2021-04-09) on lindbergh.monkeyblade.net Precedence: bulk List-ID: <linux-kernel.vger.kernel.org> X-Mailing-List: linux-kernel@vger.kernel.org X-Greylist: Sender passed SPF test, not delayed by milter-greylist-4.6.4 (snail.vger.email [0.0.0.0]); Fri, 06 Oct 2023 04:21:40 -0700 (PDT) X-getmail-retrieved-from-mailbox: INBOX X-GMAIL-THRID: 1779005016186377093 X-GMAIL-MSGID: 1779005016186377093 |
Series |
[v1] thermal: Remove Amit Kucheria from MAINTAINERS
|
|
Commit Message
Rafael J. Wysocki
Oct. 6, 2023, 11:21 a.m. UTC
From: Rafael J. Wysocki <rafael.j.wysocki@intel.com> Amit Kucheria has not been participating in kernel development in any way or form for quite some time, so it is not useful to list him as a designated reviewer for the thermal subsystem or as the maintainer of the thermal zone device bindings. Remove him from those two places accordingly. Signed-off-by: Rafael J. Wysocki <rafael.j.wysocki@intel.com> --- Documentation/devicetree/bindings/thermal/thermal-zones.yaml | 3 --- MAINTAINERS | 1 - 2 files changed, 4 deletions(-)
Comments
On Fri, 06 Oct 2023 13:21:14 +0200, Rafael J. Wysocki wrote: > From: Rafael J. Wysocki <rafael.j.wysocki@intel.com> > > Amit Kucheria has not been participating in kernel development in any > way or form for quite some time, so it is not useful to list him as a > designated reviewer for the thermal subsystem or as the maintainer of > the thermal zone device bindings. > > Remove him from those two places accordingly. > > Signed-off-by: Rafael J. Wysocki <rafael.j.wysocki@intel.com> > --- > Documentation/devicetree/bindings/thermal/thermal-zones.yaml | 3 --- > MAINTAINERS | 1 - > 2 files changed, 4 deletions(-) > My bot found errors running 'make DT_CHECKER_FLAGS=-m dt_binding_check' on your patch (DT_CHECKER_FLAGS is new in v5.13): yamllint warnings/errors: dtschema/dtc warnings/errors: /builds/robherring/dt-review-ci/linux/Documentation/devicetree/bindings/thermal/thermal-zones.yaml: 'maintainers' is a required property hint: Metaschema for devicetree binding documentation from schema $id: http://devicetree.org/meta-schemas/base.yaml# doc reference errors (make refcheckdocs): See https://patchwork.ozlabs.org/project/devicetree-bindings/patch/5716404.DvuYhMxLoT@kreacher The base for the series is generally the latest rc1. A different dependency should be noted in *this* patch. If you already ran 'make dt_binding_check' and didn't see the above error(s), then make sure 'yamllint' is installed and dt-schema is up to date: pip3 install dtschema --upgrade Please check and re-submit after running the above command yourself. Note that DT_SCHEMA_FILES can be set to your schema file to speed up checking your schema. However, it must be unset to test all examples with your schema.
On 06/10/2023 13:21, Rafael J. Wysocki wrote: > From: Rafael J. Wysocki <rafael.j.wysocki@intel.com> > > Amit Kucheria has not been participating in kernel development in any > way or form for quite some time, so it is not useful to list him as a > designated reviewer for the thermal subsystem or as the maintainer of > the thermal zone device bindings. > > Remove him from those two places accordingly. > > Signed-off-by: Rafael J. Wysocki <rafael.j.wysocki@intel.com> > --- > Documentation/devicetree/bindings/thermal/thermal-zones.yaml | 3 --- Acked-by: Krzysztof Kozlowski <krzysztof.kozlowski@linaro.org> Best regards, Krzysztof
On 06/10/2023 15:43, Krzysztof Kozlowski wrote: > On 06/10/2023 13:21, Rafael J. Wysocki wrote: >> From: Rafael J. Wysocki <rafael.j.wysocki@intel.com> >> >> Amit Kucheria has not been participating in kernel development in any >> way or form for quite some time, so it is not useful to list him as a >> designated reviewer for the thermal subsystem or as the maintainer of >> the thermal zone device bindings. >> >> Remove him from those two places accordingly. >> >> Signed-off-by: Rafael J. Wysocki <rafael.j.wysocki@intel.com> >> --- >> Documentation/devicetree/bindings/thermal/thermal-zones.yaml | 3 --- > > Acked-by: Krzysztof Kozlowski <krzysztof.kozlowski@linaro.org> and unAcked. We need a maintainer for the bindings. Someone else from thermal? Best regards, Krzysztof
On 10/6/23 14:43, Krzysztof Kozlowski wrote: > On 06/10/2023 15:43, Krzysztof Kozlowski wrote: >> On 06/10/2023 13:21, Rafael J. Wysocki wrote: >>> From: Rafael J. Wysocki <rafael.j.wysocki@intel.com> >>> >>> Amit Kucheria has not been participating in kernel development in any >>> way or form for quite some time, so it is not useful to list him as a >>> designated reviewer for the thermal subsystem or as the maintainer of >>> the thermal zone device bindings. >>> >>> Remove him from those two places accordingly. >>> >>> Signed-off-by: Rafael J. Wysocki <rafael.j.wysocki@intel.com> >>> --- >>> Documentation/devicetree/bindings/thermal/thermal-zones.yaml | 3 --- >> >> Acked-by: Krzysztof Kozlowski <krzysztof.kozlowski@linaro.org> > > and unAcked. We need a maintainer for the bindings. Someone else from > thermal? > I'm going to handle the review in thermal subsystem. Although, I forgot about this 'binding' thing... Daniel, what do you think?
On Fri, Oct 6, 2023 at 3:44 PM Krzysztof Kozlowski <krzysztof.kozlowski@linaro.org> wrote: > > On 06/10/2023 15:43, Krzysztof Kozlowski wrote: > > On 06/10/2023 13:21, Rafael J. Wysocki wrote: > >> From: Rafael J. Wysocki <rafael.j.wysocki@intel.com> > >> > >> Amit Kucheria has not been participating in kernel development in any > >> way or form for quite some time, so it is not useful to list him as a > >> designated reviewer for the thermal subsystem or as the maintainer of > >> the thermal zone device bindings. > >> > >> Remove him from those two places accordingly. > >> > >> Signed-off-by: Rafael J. Wysocki <rafael.j.wysocki@intel.com> > >> --- > >> Documentation/devicetree/bindings/thermal/thermal-zones.yaml | 3 --- > > > > Acked-by: Krzysztof Kozlowski <krzysztof.kozlowski@linaro.org> > > and unAcked. We need a maintainer for the bindings. Well, yes, we do, but how useful is it to hold on to the stale record? Surely, it doesn't help anyone. > Someone else from thermal?
On 06/10/2023 15:48, Lukasz Luba wrote: > > > On 10/6/23 14:43, Krzysztof Kozlowski wrote: >> On 06/10/2023 15:43, Krzysztof Kozlowski wrote: >>> On 06/10/2023 13:21, Rafael J. Wysocki wrote: >>>> From: Rafael J. Wysocki <rafael.j.wysocki@intel.com> >>>> >>>> Amit Kucheria has not been participating in kernel development in any >>>> way or form for quite some time, so it is not useful to list him as a >>>> designated reviewer for the thermal subsystem or as the maintainer of >>>> the thermal zone device bindings. >>>> >>>> Remove him from those two places accordingly. >>>> >>>> Signed-off-by: Rafael J. Wysocki <rafael.j.wysocki@intel.com> >>>> --- >>>> Documentation/devicetree/bindings/thermal/thermal-zones.yaml | >>>> 3 --- >>> >>> Acked-by: Krzysztof Kozlowski <krzysztof.kozlowski@linaro.org> >> >> and unAcked. We need a maintainer for the bindings. Someone else from >> thermal? >> > > I'm going to handle the review in thermal subsystem. Although, > I forgot about this 'binding' thing... > > Daniel, what do you think? I can handle the bindings, I rewrote the thermal-of code and worked with Amit on the txt to yaml conversion.
On Fri, Oct 6, 2023 at 11:44 PM Daniel Lezcano <daniel.lezcano@linaro.org> wrote: > > On 06/10/2023 15:48, Lukasz Luba wrote: > > > > > > On 10/6/23 14:43, Krzysztof Kozlowski wrote: > >> On 06/10/2023 15:43, Krzysztof Kozlowski wrote: > >>> On 06/10/2023 13:21, Rafael J. Wysocki wrote: > >>>> From: Rafael J. Wysocki <rafael.j.wysocki@intel.com> > >>>> > >>>> Amit Kucheria has not been participating in kernel development in any > >>>> way or form for quite some time, so it is not useful to list him as a > >>>> designated reviewer for the thermal subsystem or as the maintainer of > >>>> the thermal zone device bindings. > >>>> > >>>> Remove him from those two places accordingly. > >>>> > >>>> Signed-off-by: Rafael J. Wysocki <rafael.j.wysocki@intel.com> > >>>> --- > >>>> Documentation/devicetree/bindings/thermal/thermal-zones.yaml | > >>>> 3 --- > >>> > >>> Acked-by: Krzysztof Kozlowski <krzysztof.kozlowski@linaro.org> > >> > >> and unAcked. We need a maintainer for the bindings. Someone else from > >> thermal? > >> > > > > I'm going to handle the review in thermal subsystem. Although, > > I forgot about this 'binding' thing... > > > > Daniel, what do you think? > > I can handle the bindings, I rewrote the thermal-of code and worked with > Amit on the txt to yaml conversion. Sounds good! I'll send a v3 of the patch then with this change included, please ACK it.
Index: linux-pm/Documentation/devicetree/bindings/thermal/thermal-zones.yaml =================================================================== --- linux-pm.orig/Documentation/devicetree/bindings/thermal/thermal-zones.yaml +++ linux-pm/Documentation/devicetree/bindings/thermal/thermal-zones.yaml @@ -7,9 +7,6 @@ $schema: http://devicetree.org/meta-sche title: Thermal zone -maintainers: - - Amit Kucheria <amitk@kernel.org> - description: | Thermal management is achieved in devicetree by describing the sensor hardware and the software abstraction of cooling devices and thermal zones required to Index: linux-pm/MAINTAINERS =================================================================== --- linux-pm.orig/MAINTAINERS +++ linux-pm/MAINTAINERS @@ -21363,7 +21363,6 @@ F: drivers/media/radio/radio-raremono.c THERMAL M: Rafael J. Wysocki <rafael@kernel.org> M: Daniel Lezcano <daniel.lezcano@linaro.org> -R: Amit Kucheria <amitk@kernel.org> R: Zhang Rui <rui.zhang@intel.com> L: linux-pm@vger.kernel.org S: Supported